| Product Name | Amylin (8-37), rat |
| Purity | HPLC>95% |
| Description | This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism. |
| Storage | -20°C |
| References | Deems, RO. et al. Biochem. Biophys. Res. Commun. 181, 116 (1991); Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997). |
| Molecular Weight | 3200.6 |
| Sequence (One-Letter Code) | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| Sequence (Three-Letter Code) | H - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2 |
Other Products
Related Products