| Product Name | β-Defensin 2 (human) |
| Purity | HPLC>95% |
| Description | Two β-defensins (hBD1 and hBD2) have been identified in humans. β-defensins are inducible, potent, and selectively killing mainly Gram-negative bacteria and yeast. In addition, β-defensins mobilize cells engaged in adaptive immune responses. |
| Storage | -20°C |
| References | D.M. Hoover et al., J. Biol. Chem., 42, 32911 (2000) |
| Molecular Weight | 4328.23 |
| Sequence (One-Letter Code) | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Sequence (Three-Letter Code) | H-Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro-OH (Disulfide bonds, air oxidized) |
Other Products
Related Products
