| Product Name | Cecropin A |
| Purity | HPLC>95% |
| Description | Cecropin A is a 37-residue peptide with antibacterial activity against Escherichia coli, Pseudomonas aeruginosa, Bacillus megaterium and Micrococcus luteus, at micromolar concentrations. |
| Storage | -20°C |
| References | D.Andreu et al., Biochemistry, 24, 1683 (1985) D.Andreu et al., Proc. Natl. Acad. Sci. USA, 80, 6475 (1983) |
| Molecular Weight | 4003.84 |
| Sequence (One-Letter Code) | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH₂ |
| Sequence (Three-Letter Code) | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH₂ |
Other Products
Related Products