| Product Name | Defensin HNP-3 (human) |
| Purity | HPLC>95% |
| Description | |
| Storage | -20°C |
| References | F.T.Lundy et al., Oral Oncol., 40, 139 (2004) Z.Wu et al., J. Pept. Res., 64, 118 (2004) P.A.Raj et al., Biochem. J., 347, 633 (2000) |
| Molecular Weight | 3486.09 |
| Sequence (One-Letter Code) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹) |
| Sequence (Three-Letter Code) | H-Asp-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (Disulfide bonds between Cys² and Cys³⁰/Cys⁴ and Cys¹⁹/Cys⁹ and Cys²⁹) |
Other Products
Related Products
