| Product Name | Hispidalin |
| Purity | HPLC>95% |
| Description | This bioactive peptide was purified from the seeds of the medicinal plant B. hispida. Referring to the published results of Sharma and coworkers, this novel peptide showed broad and potent inhibitory effects against various human bacterial and fungal pathogens; its growth inhibition was significantly comparable with commercial antibacterial and antifungal drugs. |
| Storage | -20°C |
| References | S. Sharma et al., Int. J. Pept., 156060 (2014) |
| Molecular Weight | 5700.25 |
| Sequence (One-Letter Code) | SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR |
| Sequence (Three-Letter Code) | H-Ser-Asp-Tyr-Leu-Asn-Asn-Asn-Pro-Leu-Phe-Pro-Arg-Tyr-Asp-Ile-Gly-Asn-Val-Glu-Leu-Ser-Thr-Ala-Tyr-Arg-Ser-Phe-Ala-Asn-Gln-Lys-Ala-Pro-Gly-Arg-Leu-Asn-Gln-Asn-Trp-Ala-Leu-Thr-Ala-Asp-Tyr-Thr-Tyr-Arg-OH |
Other Products
Related Products