| Product Name | mCRAMP, mouse |
| Purity | HPLC>95% |
| Description | This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans. |
| Storage | -20°C |
| References | Limura, M. et al. J. Immunol. 174, 4901 (2005); Lopez-Garcia, B. et al. J. Invest. Dermatol. 125, 108 (2005). |
| Molecular Weight | 3878.7 |
| Sequence (One-Letter Code) | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Sequence (Three-Letter Code) | H - Gly - Leu - Leu - Arg - Lys - Gly - Gly - Glu - Lys - Ile - Gly - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Lys - Asn - Phe - Phe - Gln - Lys - Leu - Val - Pro - Gln - Pro - Glu - Gln - OH |
Other Products
Related Products