| Product Name | Beta-Amyloid (1-40) • HCl, Human |
| Purity | HPLC>95% |
| Description | All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity. |
| Storage | -20°C |
| References | Kaneko, I. et al. Nippon Yakurigaku Zasshi. 115, 67 (2000). |
| Molecular Weight | 4329.9•36.5 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH • HCl |
Beta-Amyloid (1-40) • HCl, HumanAdmin2020-12-18T12:47:58+00:00