| Product Name | Beta-Amyloid (1-40) • HFIP, Human |
| Purity | HPLC>95% |
| Description | Removal of any pre-existing structures in lyophilized stocks of Aβ-peptide is the critical initial step for controlled aggregation studies. HFIP has been shown to break down β-sheet structure, disrupt hydrophobic forces in aggregated amyloid preparations, and promotes α-helical secondary structure. HFIP treatment of lyophilized Aβ-peptide resulted in a dense, homogeneous preparation of unaggregated peptide and samples can be stored as peptide films. |
| Storage | -20°C |
| References | Stine, W.B. et al. J. Biol. Chem., 278, 11612 (2003). |
| Molecular Weight | 4329.9 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH |
Beta-Amyloid (1-40) • HFIP, HumanAdmin2020-12-18T12:48:10+00:00