| Product Name | Beta-Amyloid (1-40), Human |
| Purity | HPLC>95% |
| Description | Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. Electron microscopy of b-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist). |
| Storage | -20°C |
| References | Ref: Masters, CL. et al. Proc. Natl. Acad. Sci. USA 82, 4245 (1985); Yankner, BA. Neuron 16, 921 (1996); Geula, C. et al. Nat. Med. 4, 827 (1998); Shin, R. et al. J. Neurosci.17, 8187 (1997). |
| Molecular Weight | 4329.9 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH |
Beta-Amyloid (1-40), HumanAdmin2020-12-18T13:41:36+00:00
