| Product Name | Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human |
| Purity | HPLC>95% |
| Description | Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is biotinylated at the C-terminus. |
| Storage | -20°C |
| References | |
| Molecular Weight | 4683.4 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2 |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Lys(Biotin) - NH2 |
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, HumanAdmin2020-12-18T12:51:04+00:00