| Product Name | [Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation, Human |
| Purity | HPLC>95% |
| Description | This peptide is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide. The E22Q 'Dutch' mutant, also known as HCHWA-D, is caused by a point mutation in the beta-Amyloid encoding gene, with Glu replaced by Gln at position 22. Dutch E22Q mutation in beta-Amyloid causes familial cerebrovascular amyloidosis with abundant diffused amyloid plaque deposits. E22Q mutant and WT peptides are both stable in 'collapsed coil' conformations. The E22Q fibrils are more toxic for vascular cells than the WT fibrils. |
| Storage | -20°C |
| References | Massi, F. and J. Straub Biophys. J. 81, 697 (2001); Muñoz, F. et al. J. Neurosci. 22, 3081 (2002); Davis, J. et al. J. Biol. Chem. 279, 20296 (2004). |
| Molecular Weight | 4513.1 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gln - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH |
[Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation, HumanAdmin2020-12-18T13:18:48+00:00
