| Product Name | (Val²)-Amyloid β-Protein (1-42) |
| Purity | HPLC>95% |
| Description | A mutation very close to the β-secretase cleavage site of APP (A673V). Contrary to the protective Icelandic mutation A2T, the recessive A2V mutation may increase the risk of Alzheimer’s disease. Cantu et al. observed that APP A673V is associated with the early onset of AD-type dementia in homozygous individuals, whereas it has a protective effect in the heterozygous state. |
| Storage | -20°C |
| References | M.Rached et al., Biochim. Biophys. Acta, 1689, 229 (2004) |
| Molecular Weight | 4542.16 |
| Sequence (One-Letter Code) | DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Sequence (Three-Letter Code) | H-Asp-Val-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH |
(Val²)-Amyloid β-Protein (1-42)Admin2020-12-18T11:52:48+00:00
