Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

(Val³⁴)-Amyloid β-Protein (1-40)

Home/Beta Amyloid Peptides/(Val³⁴)-Amyloid β-Protein (1-40)
(Val³⁴)-Amyloid β-Protein (1-40)Admin2020-12-18T11:53:03+00:00
Product Name (Val³⁴)-Amyloid β-Protein (1-40)
Purity HPLC>95%
Description Cerebral amyloid angiopathy (CAA) is a common finding in Alzheimer’s disease in which amyloid-Aβ vascular deposits are featured in >80% of the cases. Mutations in the positions 21-23 (e.g. Dutch mutation E22Q) are primarily associated with CAA, although they manifest with strikingly different clinical phenotypes: cerebral hemorrhage or dementia. The Piedmont L34V Aβ mutant, located outside this hot spot, shows a similar hemorrhagic phenotype, albeit less aggressive than the widely studied Dutch variant.
Storage -20°C
References S.Fossati et al., FASEB J., 24, 229 (2010) L.Obici et al., Ann. Neurol., 58, 639 (2005)
Molecular Weight 4315.84
Sequence (One-Letter Code) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVGGVV
Sequence (Three-Letter Code) H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Val-Met-Val-Gly-Gly-Val-Val-OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

  • Ginsenoside Re
  • Semagacestat
  • Beta-Amyloid (1-42), Human
  • Beta-Amyloid (1-42), FAM-labeled, Human
  • [Met]-beta-Amyloid (1-42), 5-TAMRA labeled, Human
Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top