| Product Name | β-CGRP, human |
| Purity | HPLC>95% |
| Description | This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18. |
| Storage | -20°C |
| References | Bose, C. et al. Biochem J 280, 147 (1991). |
| Molecular Weight | 3793.4 |
| Sequence (One-Letter Code) | ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7) |
| Sequence (Three-Letter Code) | H - Ala - Cys - Asn - Thr - Ala - Thr - Cys - Val - Thr - His - Arg - Leu - Ala - Gly - Leu - Leu - Ser - Arg - Ser - Gly - Gly - Met - Val - Lys - Ser - Asn - Phe - Val - Pro - Thr - Asn - Val - Gly - Ser - Lys - Ala - Phe - NH2 (Disulfide bridge:2 - 7) |
β-CGRP, humanAdmin2021-01-04T12:30:45+00:00