| Product Name | ACTH (7-38), human |
| Purity | HPLC>95% |
| Description | Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity. |
| Storage | -20°C |
| References | Malendowicz, L. et al. J. Steroid Biochem. Mol. Biol. 67, 149 (1998); Li, CH. et al. Proc. Natl. Acad. Sci. USA 75, 4306 (1978) |
| Molecular Weight | 3659.2 |
| Sequence (One-Letter Code) | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |
| Sequence (Three-Letter Code) | H - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - OH |
ACTH (7-38), humanAdmin2021-01-04T07:17:28+00:00
