| Product Name | Adrenomedullin (1-52), human |
| Purity | HPLC>95% |
| Description | Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects. |
| Storage | -20°C |
| References | Kitamura, K. et al. (1993). Biochem Biophys Res Commun 192, 553, doi: 10.1006/bbrc.1993.1451 Hinson, JP. et al. Endocrine Rev 21 (2013), doi: http://dx.doi.org/10.1210/edrv.21.2.0396 |
| Molecular Weight | 6028.8 |
| Sequence (One-Letter Code) | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21) |
| Sequence (Three-Letter Code) | H - Tyr - Arg - Gln - Ser - Met - Asn - Asn - Phe - Gln - Gly - Leu - Arg - Ser - Phe - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2 (Disulfide bridge: 16 - 21) |
Adrenomedullin (1-52), humanAdmin2021-01-04T06:26:33+00:00
