Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Adrenomedullin (22-52), human

Home/Catalog peptide/Adrenomedullin (22-52), human
Adrenomedullin (22-52), humanAdmin2021-01-08T03:20:47+00:00
Product Name Adrenomedullin (22-52), human
Purity HPLC>95%
Description AM (22-52) is considered to be an adrenomedullin receptor antagonist and cardiostatic factor, but there are some differences in the literature on the selective use of ADM 22-52 as an adrenomedullin receptor antagonist.
Storage -20°C
References Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003).
Molecular Weight 3576
Sequence (One-Letter Code) TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence (Three-Letter Code) H - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top