| Product Name | Adrenomedullin (22-52), human |
| Purity | HPLC>95% |
| Description | AM (22-52) is considered to be an adrenomedullin receptor antagonist and cardiostatic factor, but there are some differences in the literature on the selective use of ADM 22-52 as an adrenomedullin receptor antagonist. |
| Storage | -20°C |
| References | Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003). |
| Molecular Weight | 3576 |
| Sequence (One-Letter Code) | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
| Sequence (Three-Letter Code) | H - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2 |
Adrenomedullin (22-52), humanAdmin2021-01-08T03:20:47+00:00