Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Anti-BetaGamma (MPS-Phosducin-like protein C terminus)

Home/Catalog peptide/Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)Admin2021-01-06T09:15:54+00:00
Product Name Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
Purity HPLC>95%
Description This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβϒ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins.
Storage -20°C
References 1, Orr, A. et al. J. Biol. Chem. 277, 20453 (2002) 2, Chang M. et al. J Biol Chem. 275:7021-7029 (2000).
Molecular Weight 4601.4
Sequence (One-Letter Code) AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Sequence (Three-Letter Code) H - Ala - Ala - Val - Ala - Leu - Leu - Pro - Ala - Val - Leu - Leu - Ala - Leu - Leu - Ala - Val - Thr - Asp - Gln - Leu - Gly - Glu - Asp - Phe - Phe - Ala - Val - Asp - Leu - Glu - Ala - Phe - Leu - Gln - Glu - Phe - Gly - Leu - Leu - Pro - Glu - Lys - Glu - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top