Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

Apelin-36, human

Home/Catalog peptide/Apelin-36, human
Apelin-36, humanAdmin2021-01-04T12:58:38+00:00
Product Name Apelin-36, human
Purity HPLC>95%
Description This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.
Storage -20°C
References Cayabyab, M. et al. J. Virol. 74, 11972 (2000); Reaux-Le Goazigo, A. et al. Endocrinol. 145, 4392 (2004).
Molecular Weight 4195.9
Sequence (One-Letter Code) LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Sequence (Three-Letter Code) H - Leu - Val - Gln - Pro - Arg - Gly - Ser - Arg - Asn - Gly - Pro - Gly - Pro - Trp - Gln - Gly - Gly - Arg - Arg - Lys - Phe - Arg - Arg - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top