Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide

Home/Catalog peptide/BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide
BNP-45 (51-95), rat, 5K Cardiac Natriuretic PeptideAdmin2021-01-04T13:07:09+00:00
Product Name BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide
Purity HPLC>95%
Description BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. Further, sequence identity between rat and mouse BNP prohormones is found to be more conserved in the N-terminal portion of the prohormone than in the C-terminal BNP-45 (88% versus 64%). The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence. Comparing the amino acid sequence surrounding the proteolytic processing site for BNP-32 in human, pig, and dog BNP with the corresponding site for BNP-45 in the rat and mouse sequence we find that all of the secreted BNP hormones have an N-terminal serine preceded by an arginine in the prohormone sequence, and the mouse and rat sequences are highly conserved at the putative scissile bond (LKRVLR-SQ). Further comparative sequence analysis indicates that an arginine being present at position -4 relative to the scissile (R-S) bond in all mammalian BNP precursors. Thus, processing of BNP prohormones to both BNP-45 in rodents and BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S). Also, the conserved sequences in the BNP prohormones matches the consensus cleavage site for human furin, a calcium-dependent serine endoprotease expressed in mouse heart, and possibly having a role in processing BNP precursors.
Storage -20°C
References Steinhelper, ME. Circ. Res. 72: 984-992. (1993).
Molecular Weight 5040.8
Sequence (One-Letter Code) SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Sequence (Three-Letter Code) H - Ser - Gln - Asp - Ser - Ala - Phe - Arg - Ile - Gln - Glu - Arg - Leu - Arg - Asn - Ser - Lys - Met - Ala - His - Ser - Ser - Ser - Cys - Phe - Gly - Gln - Lys - Ile - Asp - Arg - Ile - Gly - Ala - Val - Ser - Arg - Leu - Gly - Cys - Asp - Gly - Leu - Arg - Leu - Phe - OH (Disulfide bridge:23 - 39)

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top