| Product Name | C34, gp41 HIV Fragment |
| Purity | HPLC>95% |
| Description | This C34 peptide, also known as HR2, belongs to the helical region of HIV gp41. The C-terminal heptapeptide repeat 2 (HR2) is defined as the C helix or C peptide. It is known that HIV-1 enters cells through membrane fusion, and the C34-gp41 peptide is an effective inhibitor of HIV-1 fusion. |
| Storage | -20°C |
| References | Bianchi, E. et al. PNAS 102, 12903 (2005), Frey, G. et al. PNAS 103, 13938 (2006), Rosny, E. et al. J. Virol. 78, 2627 (2004). |
| Molecular Weight | 4248.6 |
| Sequence (One-Letter Code) | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
| Sequence (Three-Letter Code) | H - Trp - Met - Glu - Trp - Asp - Arg - Glu - Ile - Asn - Asn - Tyr - Thr - Ser - Leu - Ile - His - Ser - Leu - Ile - Glu - Glu - Ser - Gln - Asn - Gln - Gln - Glu - Lys - Asn - Glu - Gln - Glu - Leu - Leu - OH |
C34, gp41 HIV FragmentAdmin2021-01-13T09:28:50+00:00