Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Home/Catalog peptide/Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)Admin2021-01-06T09:18:43+00:00
Product Name Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Purity HPLC>95%
Description This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.
Storage -20°C
References Kumar, P. et al. Nature 448, 39 (2007).
Molecular Weight 4843.5
Sequence (One-Letter Code) YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Sequence (Three-Letter Code) H - Tyr - Thr - Ile - Trp - Met - Pro - Glu - Asn - Pro - Arg - Pro - Gly - Thr - Pro - Cys - Asp - Ile - Phe - Thr - Asn - Ser - Arg - Gly - Lys - Arg - Ala - Ser - Asn - Gly - Gly - Gly - Gly - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top