Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Home/Catalog peptide/Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Des-gamma-carboxylated Osteocalcin/Bone Gla ProteinAdmin2021-01-15T10:25:15+00:00
Product Name Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
Purity HPLC>95%
Description The peptide is decorboxylated osteocalcin / bone gla protein (BGP). Osteocalcin / BGP is the highest content of non collagen in bone extracellular matrix, which is secreted by osteoblasts. The peptide was used as a substrate for vitamin K-dependent carboxylase, which modified glu17, glu21 and glu24 to Glu residues.
Storage -20°C
References Houben, R. et al. Biochem J 364, 323 (2002); Ducy, P. et al. Nature 382, 448 (1996); Benton, ME. et al. Biochem 37, 13262 (1995); Engelke, J. et al. Biochim Biophys Acta 1078, 31 (1991); Ulrich, M. et al. Biochim Biophys Acta 830, 105 (1985).
Molecular Weight 5797.5
Sequence (One-Letter Code) YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
Sequence (Three-Letter Code) H - Tyr - Leu - Tyr - Gln - Trp - Leu - Gly - Ala - Pro - Val - Pro - Tyr - Pro - Asp - Pro - Leu - Glu - Pro - Arg - Arg - Glu - Val - Cys - Glu - Leu - Asn - Pro - Asp - Cys - Asp - Glu - Leu - Ala - Asp - His - Ile - Gly - Phe - Gln - Glu - Ala - Tyr - Arg - Arg - Phe - Tyr - Gly - Pro - Val - OH (Disulfide bridge:C23 - 29)

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top