| Product Name | Exendin 4, FAM-labeled |
| Purity | HPLC>95% |
| Description | This full-length exendin4 amide peptide is labeled with a fluorescent dye (FAM) at its N-terminus, Abs/Em=494/519nm. The glucagon-like peptide 1 (GLP-1) receptor agonist Exendin-4 induces insulin release after eating. Exendin-4 shares 53% homology with GLP-1. Exendin-4 is derived from Gila monster, Heloderma suspectim. Its half-life in plasma is longer than GLP-1, so it is a more effective insulinotropic agent |
| Storage | -20°C |
| References | Eng, J. et al. J Biol Chem 267, 7402 (1992) Greig, NH. et al. Diabetolog 42, 45 (1999) Göke R. et al. J Biol Chem 268, 19650 (1993) |
| Molecular Weight | 4545 |
| Sequence (One-Letter Code) | FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Sequence (Three-Letter Code) | FAM - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2 |
Exendin 4, FAM-labeledAdmin2021-01-07T07:10:16+00:00
