| Product Name | Exendin (9-39) |
| Purity | HPLC>95% |
| Description | This truncated Exendin-4 peptide, Exendin(9-39) amide, is a highly potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Unlike full-length Exendin-4 (GLP-1 agonist), Exendin (9-39) antagonizes GLP-1 stimulated insulin release after eating. It is a competitive inhibitor of Exendin-3 and Exendin-4 |
| Storage | -20°C |
| References | Montrose-Rafizadeh, C. et al. J Biol Chem 272, 21201 (1997) Eng, J. et al. J Biol Chem 267, 7402 (1992) Greig, NH. et al. Diabetolog 42, 45 (1999) Göke R. et al. J Biol Chem 268, 19650 (1993) |
| Molecular Weight | 3369.8 |
| Sequence (One-Letter Code) | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Sequence (Three-Letter Code) | H - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2 |
Exendin (9-39)Admin2021-01-07T07:08:07+00:00