Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

Gastrin Releasing Peptide, human

Home/Catalog peptide/Gastrin Releasing Peptide, human
Gastrin Releasing Peptide, humanAdmin2021-01-08T02:44:49+00:00
Product Name Gastrin Releasing Peptide, human
Purity HPLC>95%
Description Gastrin releasing peptide (Gastrin releasing peptide, referred to as Gastrin releasing peptide) is a 27-amino acid peptide isolated from the intestine, which can stimulate the release of gastrin. It shares the same C-terminal decapeptide with bombesin. Source. Gastrin releasing peptide is an important growth regulator in the development of lung epithelium. It is used as a tumor marker for the diagnosis of small cell lung cancer because it is known to be produced by these cancer cells.
Storage -20°C
References Kamata, K. et al. Nephrol Dialysis Transplant 11, 1267 (1996), doi: 10.1093/ndt/11.7.1267 Taché, Y. et al. Gastroenterol 81, 298 (1981) Siegfried, J. et al. J Biol Chem 269, 8596 (1994) Patel, O. et al. Biochem Pharmacol 68, 2129 (2004), doi: 10.1016/j.bcp.2004.08.009 Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x.
Molecular Weight 2859.4
Sequence (One-Letter Code) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence (Three-Letter Code) H - Val - Pro - Leu - Pro - Ala - Gly - Gly - Gly - Thr - Val - Leu - Thr - Lys - Met - Tyr - Pro - Arg - Gly - Asn - His - Trp - Ala - Val - Gly - His - Leu - Met - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top