Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

GIP (1-42), human

Home/Catalog peptide/GIP (1-42), human
GIP (1-42), humanAdmin2021-01-07T07:12:28+00:00
Product Name GIP (1-42), human
Purity HPLC>95%
Description GIP (glucose-dependent insulinotropic polypeptide, also known as gastric inhibitory polypeptide) is a 42 amino acid peptide released by K cells in the duodenum and jejunum after eating. GIP and GLP (gastric-like peptides) are members of the incretin hormone peptide family, which can stimulate pancreatic β-cells to secrete insulin, and promote β-cell proliferation and β-cell survival. Recent studies have shown that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity.
Storage -20°C
References Brown, JC & JR Dryburgh Can J Biochem 49, 867 (1971), doi: 10.1139/o71-122 Buchan, MT. et al. Histochem 56, 37 Dupre, J. et al. J Clin Endocrinol Metab 37, 826 (1973), doi: http://dx.doi.org/10.1210/jcem-37-5-826 Getty-Kaushik, L. et al. Obesity 14, 1124, doi: 10.1038/oby.2006.129
Molecular Weight 4983.6
Sequence (One-Letter Code) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Sequence (Three-Letter Code) H - Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top