| Product Name | GIP (1-42), human |
| Purity | HPLC>95% |
| Description | GIP (glucose-dependent insulinotropic polypeptide, also known as gastric inhibitory polypeptide) is a 42 amino acid peptide released by K cells in the duodenum and jejunum after eating. GIP and GLP (gastric-like peptides) are members of the incretin hormone peptide family, which can stimulate pancreatic β-cells to secrete insulin, and promote β-cell proliferation and β-cell survival. Recent studies have shown that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity. |
| Storage | -20°C |
| References | Brown, JC & JR Dryburgh Can J Biochem 49, 867 (1971), doi: 10.1139/o71-122 Buchan, MT. et al. Histochem 56, 37 Dupre, J. et al. J Clin Endocrinol Metab 37, 826 (1973), doi: http://dx.doi.org/10.1210/jcem-37-5-826 Getty-Kaushik, L. et al. Obesity 14, 1124, doi: 10.1038/oby.2006.129 |
| Molecular Weight | 4983.6 |
| Sequence (One-Letter Code) | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Sequence (Three-Letter Code) | H - Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH |
GIP (1-42), humanAdmin2021-01-07T07:12:28+00:00