Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

GIP (3-42), human

Home/Catalog peptide/GIP (3-42), human
GIP (3-42), humanAdmin2021-01-07T07:13:50+00:00
Product Name GIP (3-42), human
Purity HPLC>95%
Description This peptide is a long GIP (glucose-dependent insulinotropic polypeptide or gastric inhibitory polypeptide) composed of a full length of 42 amino acids with amino acids 3-42. The first two N-terminal amino acids (Tyr-Ala) are degraded by dipeptidyl peptidase IV (DPP-IV) in the body, making GIP (3-42) an effective antagonist, rather than the full-on GIP receptor. Long GIP
Storage -20°C
References Gault, VA. et al. Endocrinol 175, 525 (2002), doi: 10.1677/joe.0.1750525
Molecular Weight 4759.4
Sequence (One-Letter Code) EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Sequence (Three-Letter Code) H - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top