| Product Name | GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human |
| Purity | HPLC>95% |
| Description | Glucagon-like peptide-2 (GLP-2) promotes the absorption of nutrients by stimulating the proliferation of small intestinal crypt cells and inhibiting cell apoptosis. It also reduces the permeability of the epithelium and reduces gastric acid secretion and gastrointestinal motility caused by eating. GLP-2 stimulates the GLP-2 receptor, which is a member of the glucagon secretin G protein-coupled receptor superfamily, thereby promoting the expansion of the intestinal epithelium. |
| Storage | -20°C |
| References | Yusta, B. et al. J Biol Chem 274, 30459 (1999) Drucker, D. Gastroenterol 122, 531 (2002). |
| Molecular Weight | 3922.4 |
| Sequence (One-Letter Code) | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
| Sequence (Three-Letter Code) | H - His - Ala - Asp - Gly - Ser - Phe - Ser - Asp - Glu - Met - Asn - Thr - Ile - Leu - Asp - Asn - Leu - Ala - Ala - Arg - Asp - Phe - Ile - Asn - Trp - Leu - Ile - Gln - Thr - Lys - Ile - Thr - Asp - Arg - OH |
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), humanAdmin2021-01-07T07:16:32+00:00