Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Glucagon (1-29), bovine, human, porcine, FAM-labeled

Home/Catalog peptide/Glucagon (1-29), bovine, human, porcine, FAM-labeled
Glucagon (1-29), bovine, human, porcine, FAM-labeledAdmin2021-01-07T07:24:28+00:00
Product Name Glucagon (1-29), bovine, human, porcine, FAM-labeled
Purity HPLC>95%
Description This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Storage -20°C
References O'Harte. FP. et. al. Mol Cell Endocrinol 381, 26 (2013), doi: 10.1016/j.mce.2013.07.014 Drucker DJ. Endocrinology: Adult and Pediatric (7th Ed.) 1, 586 (2016), doi:10.1016/B978-0-323-18907-1.00034-2
Molecular Weight 3841.1
Sequence (One-Letter Code) FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Sequence (Three-Letter Code) FAM - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top