Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Glucagon (1-37), Oxyntomodulin, porcine

Home/Catalog peptide/Glucagon (1-37), Oxyntomodulin, porcine
Glucagon (1-37), Oxyntomodulin, porcineAdmin2021-01-07T07:28:09+00:00
Product Name Glucagon (1-37), Oxyntomodulin, porcine
Purity HPLC>95%
Description After nutrient intake, GLP-1 and Oxyntomodulin (OXM) are both processed by proglucagon and secreted by polydine-1 cells in the intestine. Oxyntomodulin (OXM) is a 37-amino acid peptide hormone that can cause weight loss in humans and rodents. It activates the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). Its sequence is the same as glucagon (1-29), but with an extra KRNKNNIA c-terminal sequence.
Storage -20°C
References Pocai A. Mol Metab 3, 241 (2014), doi:10.1016/j.molmet.2013.12.001
Molecular Weight 4421.9
Sequence (One-Letter Code) HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Sequence (Three-Letter Code) H - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - Lys - Arg - Asn - Lys - Asn - Asn - Ile - Ala - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top