Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human

Home/Catalog peptide/Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human
Glucagon-Like Peptide 1, GLP-1 (7-36), amide, humanAdmin2021-01-07T08:38:15+00:00
Product Name Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human
Purity HPLC>95%
Description GLP-1 (7-36) amide is an endocrine hormone that causes insulin-dependent release through pancreatic β cells. It is a cleavage product of GLP-1 (1-36) amide peptide. GLP-1 (7-36) and GLP-1 (7-37) are also gastric motility (gastric emptying), suppress plasma glucagon levels (glucose production) and may promote the satisfaction of glucose processing in peripheral tissues And stimulating effect, independent of insulin action. GLP-1 (7-36) has a short half-life of less than 2 minutes. Like GIP, it is rapidly produced by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed at multiple sites including small intestinal arteriole endothelial cells. degradation. DPP-4 degrades GLP-1 (7-36) into non-insulin GLP-1 (9-36) (some studies indicate that it may have weak insulin sensitizing activity). As a result, GLP-1 (and GIP) is mostly inactivated as an insulin tropism before reaching the systemic circulation.
Storage -20°C
References Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160 Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7 Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229 Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
Molecular Weight 3297.7
Sequence (One-Letter Code) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence (Three-Letter Code) H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top