Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Glucagon-Like Peptide 1, GLP-1 (7-37)

Home/Catalog peptide/Glucagon-Like Peptide 1, GLP-1 (7-37)
Glucagon-Like Peptide 1, GLP-1 (7-37)Admin2021-01-07T08:41:58+00:00
Product Name Glucagon-Like Peptide 1, GLP-1 (7-37)
Purity HPLC>95%
Description GLP-1(7-37) is an insulin-stimulating hormone, which can cause glucose-dependent release of insulin by pancreatic cells. It is a cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) are involved in gastric motility (gastric emptying), inhibit plasma glucagon levels (glucose production), and may promote it independently of insulin action Peripheral tissues feel full and stimulate glucose processing. Although GLP-1 (7-37) has biological activity, its content is lower than GLP-1 (7-36), and it is not amidated
Storage -20°C
References Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002) Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001) Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004) Rothstein, JD. et al. Neuron 16, 675 (1996)
Molecular Weight 3355.7
Sequence (One-Letter Code) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence (Three-Letter Code) H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Gly - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top