Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled

Home/Catalog peptide/Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled
Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeledAdmin2021-01-07T08:44:35+00:00
Product Name Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled
Purity HPLC>95%
Description This is the fluorescent GLP-1 labeled with FAM at the c-terminus of the peptide, Abs/Em=494/521 nm. In small intestinal L cells, proglucagon is cleaved into GLP-1 (1-36) due to glucose uptake. Before secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36) and a small amount of glycine-extended GLP-1 (7-37). Both GLP-1(7-36) and GLP-1(7-37) can cause glucose-dependent release of insulin by pancreatic cells. They also inhibit gastric motility (gastric emptying), suppress plasma glucagon levels (glucose production), and may play a role in promoting satiety and stimulating glucose processing in peripheral tissues, independent of insulin. GLP-1 polypeptides such as GLP-1 (1-36) have been used to study the recovery of pancreatic cell function. GLP-1 is also produced in the central nervous system
Storage -20°C
References Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160 Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7.
Molecular Weight 4469.8
Sequence (One-Letter Code) FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence (Three-Letter Code) FAM - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top