Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

hBD-1, β-Defensin-1, human

Home/Catalog peptide/hBD-1, β-Defensin-1, human
hBD-1, β-Defensin-1, humanAdmin2021-01-07T06:29:38+00:00
Product Name hBD-1, β-Defensin-1, human
Purity HPLC>95%
Description This is a 3.9kDa peptide of 36 amino acids called -defensin-1 (hBD-1), which has a peptide plate with three intramolecular disulfide bonds. It is composed of various epithelial tissues including urogenital tract and respiratory tract. Its expression can also be induced in human skin keratinocytes by lipopolysaccharide and peptidoglycan. hBD-1 exhibits antibacterial activity against several pathogenic microorganisms including Escherichia coli, although its activity depends on salt sensitivity because it is inhibited by salt in a concentration-dependent manner. In addition to antibacterial activity, hBD-1 can also attract HEK293 cells expressing CC chemokine receptor (CCR) 6, which indicates that the peptide uses CCR6 as a receptor
Storage -20°C
References Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005).
Molecular Weight 3929.6
Sequence (One-Letter Code) DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
Sequence (Three-Letter Code) H - Asp - His - Tyr - Asn - Cys - Val - Ser - Ser - Gly - Gly - Gln - Cys - Leu - Tyr - Ser - Ala - Cys - Pro - Ile - Phe - Thr - Lys - Ile - Gln - Gly - Thr - Cys - Tyr - Arg - Gly - Lys - Ala - Lys - Cys - Cys - Lys - OH (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top