Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

hBD-3, β-Defensin-3, human

Home/Catalog peptide/hBD-3, β-Defensin-3, human
hBD-3, β-Defensin-3, humanAdmin2021-01-07T06:35:53+00:00
Product Name hBD-3, β-Defensin-3, human
Purity HPLC>95%
Description This is a 5.1kDa 45 amino acid antimicrobial peptide called β-defensin-3 (hBD-3), a β sheet with three intramolecular disulfide bonds. It is expressed in keratinocytes and tonsil tissues, but low in the respiratory tract, gastrointestinal tract and genital urothelium. The factors that induce its expression include TNFα, IL-1beta, and bacteria such as Pseudomonas aeruginosa and Staphylococcus aureus. hBD-3 may also be induced after exposure to IFNγ. Compared with hBD-1, -2 and -4, hBD-3 shows insensitive anti-salt and anti-bacterial activity to several pathogenic microorganisms at physiological salt concentration. This makes hBD-3 unique and particularly relevant in other diseases where hBD is inactive. Compared with hBD-1(+4) and hBD-2(+6), hBD-3 can stimulate its antibacterial activity more effectively at lower concentrations due to its amphiphilic dimer structure and front surface Due to the increase in charge (+9). hBD-3 can induce human keratinocytes to produce cytokines and stimulate monocyte migration
Storage -20°C
References 1, Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005). 2, Dhople, V. et al. Biochim. Biophys. Acta 1758, 1499 (2006). 3, Cole, A. Protein and Peptide Lett 12, 41 (2005).
Molecular Weight 5155.2
Sequence (One-Letter Code) GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
Sequence (Three-Letter Code) H - Gly - Ile - Ile - Asn - Thr - Leu - Gln - Lys - Tyr - Tyr - Cys - Arg - Val - Arg - Gly - Gly - Arg - Cys - Ala - Val - Leu - Ser - Cys - Leu - Pro - Lys - Glu - Glu - Gln - Ile - Gly - Lys - Cys - Ser - Thr - Arg - Gly - Arg - Lys - Cys - Cys - Arg - Arg - Lys - Lys - OH (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41)

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top