Warning: Undefined array key "url" in /www/wwwroot/mnbt.11370829f/wp-content/plugins/wpforms-lite/src/Forms/IconChoices.php on line 127

Warning: Undefined array key "path" in /www/wwwroot/mnbt.11370829f/wp-content/plugins/wpforms-lite/src/Forms/IconChoices.php on line 128
Histone H3 (1-50)-GGK(Biotin), biotin-labeled - Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Histone H3 (1-50)-GGK(Biotin), biotin-labeled

Home/Catalog peptide/Histone H3 (1-50)-GGK(Biotin), biotin-labeled
Histone H3 (1-50)-GGK(Biotin), biotin-labeledAdmin2021-01-12T06:40:35+00:00
Product Name Histone H3 (1-50)-GGK(Biotin), biotin-labeled
Purity HPLC>95%
Description This peptide is histone H3 (1-50) biotinylated via the C-terminal GGK linker. When the peptide purity is greater than 95%, the peptide is dissolved in distilled water at a concentration of 1 mg/ml, and lyophilized again into a powder form.
Storage -20°C
References
Molecular Weight 5809.8
Sequence (One-Letter Code) ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG-K(Biotin)
Sequence (Three-Letter Code) H - Ala - Arg - Thr - Lys - Gln - Thr - Ala - Arg - Lys - Ser - Thr - Gly - Gly - Lys - Ala - Pro - Arg - Lys - Gln - Leu - Ala - Thr - Lys - Ala - Ala - Arg - Lys - Ser - Ala - Pro - Ala - Thr - Gly - Gly - Val - Lys - Lys - Pro - His - Arg - Tyr - Arg - Pro - Gly - Thr - Val - Ala - Leu - Arg - Glu - Gly - Gly - Lys(Biotin) - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top