| Product Name | Histone H3 (1-50)-GGK(Biotin), biotin-labeled |
| Purity | HPLC>95% |
| Description | This peptide is histone H3 (1-50) biotinylated via the C-terminal GGK linker. When the peptide purity is greater than 95%, the peptide is dissolved in distilled water at a concentration of 1 mg/ml, and lyophilized again into a powder form. |
| Storage | -20°C |
| References | |
| Molecular Weight | 5809.8 |
| Sequence (One-Letter Code) | ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG-K(Biotin) |
| Sequence (Three-Letter Code) | H - Ala - Arg - Thr - Lys - Gln - Thr - Ala - Arg - Lys - Ser - Thr - Gly - Gly - Lys - Ala - Pro - Arg - Lys - Gln - Leu - Ala - Thr - Lys - Ala - Ala - Arg - Lys - Ser - Ala - Pro - Ala - Thr - Gly - Gly - Val - Lys - Lys - Pro - His - Arg - Tyr - Arg - Pro - Gly - Thr - Val - Ala - Leu - Arg - Glu - Gly - Gly - Lys(Biotin) - OH |
Histone H3 (1-50)-GGK(Biotin), biotin-labeledAdmin2021-01-12T06:40:35+00:00