| Product Name | Nesfatin-1 (24-53), human |
| Purity | HPLC>95% |
| Description | Nesfatin-1 is an anorectic peptide derived from nuclear binding protein 2. Nesfatin-1 can reduce weight gain, food and water intake in rodents. High levels of Nesfatin-1 in human plasma are associated with overweight individuals. In addition, Nesfatin-1 is related to anxiety and stress. |
| Storage | -20°C |
| References | 1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013) 2. Vas S., et.al., PLOS 8 (4), 1-10 (2013) 3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010) |
| Molecular Weight | 3685.3 |
| Sequence (One-Letter Code) | PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2 |
| Sequence (Three-Letter Code) | Pro - Asp - Thr - Gly - Leu - Tyr - Tyr - Asp - Glu - Tyr - Leu - Lys - Gln - Val - Ile - Asp - Val - Leu - Glu - Thr - Asp - Lys - His - Phe - Arg - Glu - Lys - Leu - Gln - Lys - NH2 |
Nesfatin-1 (24-53), humanAdmin2021-01-15T07:05:03+00:00