Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

Nesfatin-1 (24-53), mouse

Home/Catalog peptide/Nesfatin-1 (24-53), mouse
Nesfatin-1 (24-53), mouseAdmin2021-01-15T07:06:28+00:00
Product Name Nesfatin-1 (24-53), mouse
Purity HPLC>95%
Description NESFOTIN-1 is recently identified as an anorectic peptide, which is derived from nucleoside proteins. Nestle protein-1 reduces weight gain, food and water intake in rodents. In humans, high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 is related to anxiety and stress.
Storage -20°C
References 1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013) 2. Vas S., et.al., PLOS 8 (4), 1-10 (2013) 3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010)
Molecular Weight 3672.3
Sequence (One-Letter Code) PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2
Sequence (Three-Letter Code) Pro - Asp - Thr - Gly - Leu - Tyr - Tyr - Asp - Glu - Tyr - Leu - Lys - Gln - Val - Ile - Glu - Val - Leu - Glu - Thr - Asp - Pro - His - Phe - Arg - Glu - Lys - Leu - Gln - Lys - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top