Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

PACAP (1-27), amide, human, ovine, rat

Home/Catalog peptide/PACAP (1-27), amide, human, ovine, rat
PACAP (1-27), amide, human, ovine, ratAdmin2021-01-08T03:34:18+00:00
Product Name PACAP (1-27), amide, human, ovine, rat
Purity HPLC>95%
Description PACAP-27 is the N-terminal fragment of PACAP-38, a neuropeptide originally isolated from bovine hypothalamus, but it also exists in humans and rats. It has considerable homology with vasoactive intestinal peptide (VIP), but its stimulating effect on adenylate cyclase is much stronger than VIP. PACAP27 and PACAP38 stimulate the accumulation of cAMP through the type I PACAP receptor and increase [Ca2+]i.
Storage -20°C
References Ref: Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996).
Molecular Weight 3147.7
Sequence (One-Letter Code) HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Sequence (Three-Letter Code) H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top