Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

PACAP (1-38), amide, human, ovine, rat

Home/Catalog peptide/PACAP (1-38), amide, human, ovine, rat
PACAP (1-38), amide, human, ovine, ratAdmin2021-01-08T04:26:38+00:00
Product Name PACAP (1-38), amide, human, ovine, rat
Purity HPLC>95%
Description Pituitary adenylate cyclase activating peptide (PACAP) is a member of the vasoactive intestinal peptide/secretin/glucagon family, and its amino acid sequence homology with vasoactive intestinal peptide (VIP) is 68%. PACAP38 is derived from a 176 amino acid precursor (pre-opacap), which is a 38 amino acid polypeptide and was found to be a sheep hypothalamic neuropeptide. The amino acid sequence of PACAP is the same in all mammals, in chickens, frogs, salmon and other species, only 1-3 amino acids are different. It is abundant in the central nervous system and peripheral nervous system, and has many functions. PACAP may act as a parasympathetic nerve and sensory neurotransmitter in pancreatic islets. PACAP stimulates pancreatic islets to secrete insulin in a glucose-dependent manner, and its role is an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides that regulate innate immunity and adaptive immunity. VIP/PACAP protects T cells from activation-induced cell death by down-regulating Fas ligand. PACAP immunoreactivity was also found in the nerve fibers of the ganglia and pancreatic islets in the pancreas. It is known that PACAP (1-38) stimulates adenylate cyclase to a much greater extent than VIP.
Storage -20°C
References Ref: Miyata, A. et al. BBRC 173, 1271 (1990).
Molecular Weight 4534.3
Sequence (One-Letter Code) HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence (Three-Letter Code) H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top