Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Pancreatic Polypeptide, human

Home/Catalog peptide/Pancreatic Polypeptide, human
Pancreatic Polypeptide, humanAdmin2021-01-07T08:50:19+00:00
Product Name Pancreatic Polypeptide, human
Purity HPLC>95%
Description Pancreatic Polypeptide (PP) is a 36 amino acid anorectic peptide hormone secreted by pancreatic PP cells. It is released quickly after a meal and continues to rise for about 4-6 hours after a meal. PP regulates food intake, but it does not exist in children with Prader-Willi syndrome. The secretion of PP can be achieved by electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and gastrin seem to be involved in its secretion, while growth hormone and obestatin have been reported to inhibit its release. PP is related to peptide YY and neuropeptide Y (NPY).
Storage -20°C
References Williams, JA. Pancreapedia (2014), doi: 10.3998/panc.2014.4 Khandekar, N. et al. Mol Cell Endocrinol (2015), doi: 10.1016/j.mce.2015.06.028
Molecular Weight 4181.8
Sequence (One-Letter Code) APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Sequence (Three-Letter Code) H - Ala - Pro - Leu - Glu - Pro - Val - Tyr - Pro - Gly - Asp - Asn - Ala - Thr - Pro - Glu - Gln - Met - Ala - Gln - Tyr - Ala - Ala - Asp - Leu - Arg - Arg - Tyr - Ile - Asn - Met - Leu - Thr - Arg - Pro - Arg - Tyr - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top