| Product Name | Peptide YY, human |
| Purity | HPLC>95% |
| Description | PYY is an intestinal hormone regulated by 36 amino acids, which exists in intestinal endocrine cells. This peptide has both endocrine and paracrine functions. |
| Storage | -20°C |
| References | Ref: Tatemoto, K. et al. BBRC 157, 713 (1988); Halldén, G. and G. Aponte, J. Biol. Chem. 272, 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003). |
| Molecular Weight | 4309.8 |
| Sequence (One-Letter Code) | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Sequence (Three-Letter Code) | H - Tyr - Pro - Ile - Lys - Pro - Glu - Ala - Pro - Gly - Glu - Asp - Ala - Ser - Pro - Glu - Glu - Leu - Asn - Arg - Tyr - Tyr - Ala - Ser - Leu - Arg - His - Tyr - Leu - Asn - Leu - Val - Thr - Arg - Gln - Arg - Tyr - NH2 |
Peptide YY, humanAdmin2021-01-07T08:55:05+00:00