| Product Name | Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) |
| Purity | HPLC>95% |
| Description | This peptide is a 3614-3643 amino acid fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin-binding peptide (CaMBP), which belongs to a type of intracellular calcium channel. It is the main cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor itself is activated by intracellular calcium. |
| Storage | -20°C |
| References | Kovaks, E. et al. J Biol Chem 285, 1799 (2010). |
| Molecular Weight | 3616.4 |
| Sequence (One-Letter Code) | KSKKAVWHKLLSKQRRRAVVACFRMTPLYN |
| Sequence (Three-Letter Code) | H - Lys - Ser - Lys - Lys - Ala - Val - Trp - His - Lys - Leu - Leu - Ser - Lys - Gln - Arg - Arg - Arg - Ala - Val - Val - Ala - Cys - Phe - Arg - Met - Thr - Pro - Leu - Tyr - Asn - OH |
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)Admin2021-01-13T09:44:25+00:00
