| Product Name | TAT-HA2 Fusion Peptide |
| Purity | HPLC>95% |
| Description | This sequence is the 1-20 amino acids of the influenza A virus hemagglutinin protein (HA2) linked to a 10-amino acid cell-permeable HIV trans-transcription activator (TAT) protein transduction domain (PTD). TAT-HA2 is a macromolecular drug delivery peptide. TAT-PTD binds to the cell surface and penetrates the cell membrane through the action of lipid raft-dependent large granular cells. The HA2 domain is a pH-sensitive lipid membrane destabilizing sequence, which can promote endosomal escape and transduction of the fusion peptide |
| Storage | -20°C |
| References | Wadia, J. et al. Nature Med 10, 310 (2004). |
| Molecular Weight | 3433 |
| Sequence (One-Letter Code) | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG |
| Sequence (Three-Letter Code) | H - Arg - Arg - Arg - Gln - Arg - Arg - Lys - Lys - Arg - Gly - Gly - Asp - Ile - Met - Gly - Glu - Trp - Gly - Asn - Glu - Ile - Phe - Gly - Ala - Ile - Ala - Gly - Phe - Leu - Gly - OH |
TAT-HA2 Fusion PeptideAdmin2021-01-06T09:59:49+00:00
