Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

TIP 39, Tuberoinfundibular Neuropeptide

Home/Catalog peptide/TIP 39, Tuberoinfundibular Neuropeptide
TIP 39, Tuberoinfundibular NeuropeptideAdmin2021-01-16T09:16:03+00:00
Product Name TIP 39, Tuberoinfundibular Neuropeptide
Purity HPLC>95%
Description This is a pulmonary infundibulum neuropeptide and parathyroid hormone 2 (PTH 2) - receptor agonist from hypothalamus. The synthesized tip 39 activated PTH2 receptor in human and rat.
Storage -20°C
References Ref: Usdin, TB. et al. Nat. Am. 2, 941 (1999); Piserchio, A. et al. J. Biol. Chem. 275, 27284 (2000).
Molecular Weight 4504.3
Sequence (One-Letter Code) SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Sequence (Three-Letter Code) H - Ser - Leu - Ala - Leu - Ala - Asp - Asp - Ala - Ala - Phe - Arg - Glu - Arg - Ala - Arg - Leu - Leu - Ala - Ala - Leu - Glu - Arg - Arg - His - Trp - Leu - Asn - Ser - Tyr - Met - His - Lys - Leu - Leu - Val - Leu - Asp - Ala - Pro - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top