Catalog Peptides

/Catalog Peptides
Catalog Peptides 2020-08-24T09:15:57+08:00

目录肽

Bestbiochem为全世界科研工作者提供高质量、高性价比的研究用多肽。

我们经验丰富的技术人员采用分段合成法、微波合成法等多种合成技术使合成成功率达到98%以上。

多重检测程序,包括纯化前检测、纯化后检测,出货前检测,保证每条多肽均能达到客户的要求。

起订量:1mg

纯度可选:粗肽、脱盐、>70%、>80%、>90%、>95%、>98%、>99%

其他服务:免费分装

联系我们:[email protected]

Product NamePeptide Sequence
SauvaginePyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2
Biotin-ACTH (1-39), humanBiotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
ACTH (7-38), humanFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
ACTH (18-39), humanRPVKVYPNGAEDESAEAFPLEF
ACTH (1-39), humanSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
ACTH (1-24), humanSYSMEHFRWGKPVGKKRRPVKVYP
ACTH (1-17)SYSMEHFRWGKPVGKKR
ACTH (1-10)SYSMEHFRWG
Adrenomedullin (1-50), ratYRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, AmideKCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
Biotin-Amylin (1-37), amide, humanBiotin-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (disulfide bridge: 2-7)
Amylin (8-37), ratATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Amylin (20-29), humanSNNFGAILSS
Amylin (1-37), rat, mouseKCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
[NMeG24, NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22-27)NF-(NMe-G)-A-(NMe-I)-L
Beta-Amyloid (13-28), HumanHHQKLVFFAEDVGSNK
Beta-Amyloid (17-28), Human, mouse/ratLVFFAEDVGSNK
[Pro18]-Beta-Amyloid (12-28); V8P Beta-Amyloid (12-28); Aβ12-28P, HumanVHHQKLPFFAEDVGSNK
Beta-Amyloid (12-28), HumanVHHQKLVFFAEDVGSNK
Beta-Amyloid (1-28)-Lys(Biotin)-NH2, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Beta-Amyloid (1-28), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNK
Beta-Amyloid (1-40), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (1-40) • HCl, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl
Beta-Amyloid (1-40) • HFIP, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HFIP
Beta-Amyloid Peptide (1-40), mouse, ratDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Scrambled-beta-Amyloid (1-40), HumanAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Beta-Amyloid (40-1), HumanVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Biotin-beta-Amyloid (1-40), HumanBiotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Biotin-LC-beta-Amyloid (1-40), HumanBiotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Beta-Amyloid (1-40)-Lys(Biotin-LC), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin-LC)
Beta-Amyloid (1-40)-Lys(LC-biotin)-NH2, FAM-labeled, Human5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, ratDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Beta-Amyloid (1-40), FAM-labeled, HumanFAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (1-40), TAMRA-labeled, HumanTAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Cys-beta-Amyloid (1-40), HumanCDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (1-40)-Cys, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
[Arg6]-beta-Amyloid (1-40), English Mutation, HumanDAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
[Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation, HumanDAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
[Gly21]-beta-Amyloid (1-40), A21G, Flemish Mutation, HumanDAEFRHDSGYEVHHQKLVFFGEDVGSNKGAIIGLMVGGVV
[Gln22]-beta-Amyloid (1-40), Dutch Mutation, HumanDAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
[Gln22, Asn23]-beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa double mutation, HumanDAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
[Gly22]-beta-Amyloid (1-40), Arctic Mutation, HumanDAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
[Lys22]-beta-Amyloid (1 - 40), Italian Mutation, HumanDAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
[Asn23]-beta-Amyloid (1-40), Iowa Mutation, HumanDAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
[Cys26]-beta-Amyloid (1-40), S26C beta-Amyloid (1-40), HumanDAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Beta-Amyloid (2-40), HumanAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (3-40), HumanEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
[Pyr3]-beta-Amyloid (3-40), HumanPyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (11-40), HumanEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (11-40), FAM-labeled, Human5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (17-40), Human, mouse/ratLVFFAEDVGSNKGAIIGLMVGGVV
Biotin-beta-Amyloid (17-40), Human, mouse/ratBiotin-LVFFAEDVGSNKGAIIGLMVGGVV
Beta-Amyloid (1-40) Binding Peptide, Biotin-labeledBiotin-DWGKGGRWRLWPGASGKTEA
Beta-Amyloid (1-42), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (1-42) • HCl, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA • HCl
Biotin-beta-Amyloid (1-42), HumanBiotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Biotin-LC-beta-Amyloid (1-42), HumanBiotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (1-42)-Lys(Biotin)-NH2, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
Beta-Amyloid (1-42) • HFIP, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA • HFIP
Beta-Amyloid (1-42), sodium salt, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid Peptide (1-42), mouse, ratDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Cys-beta-Amyloid (1-42), HumanCDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Scrambled-beta-Amyloid (1-42), HumanAIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Beta-Amyloid (1-42), Scrambled, 5-FAM labeled, Human5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Beta-Amyloid (42-1), HumanAIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Beta-Amyloid (1-42), FAM-labeled, HumanFAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[Met]-beta-Amyloid (1-42), 5-TAMRA labeled, Human5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[Arg6]-beta-Amyloid (1-42), English Mutation, HumanDAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation, HumanDAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[Pro19]-beta-Amyloid (1-42); F19P beta-Amyloid (1-42), HumanDAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA
[Gly21]-beta-Amyloid (1-42), A21G Flemish Mutation, HumanDAEFRHDSGYEVHHQKLVFFGEDVGSNKGAIIGLMVGGVVIA
[Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation, HumanDAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
[Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, HumanDAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
[Lys22]-beta-Amyloid (1-42), Italian Mutation, HumanDAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
[Asn23]-beta-amyloid (1-42), Iowa Mutation, HumanDAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
[Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), HumanDAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
[Met(O)35]-beta-Amyloid (1-42), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Beta-Amyloid (2-42), HumanAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (3-42), HumanEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[Pyr3]-beta-Amyloid (3-42), HumanPyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (4-42), HumanFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (5-42), HumanRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (9-42), HumanGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (11-42), HumanEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
[Pyr11]-beta-Amyloid (11-42), HumanPyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (20-42), Human, mouse/ratFAEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (22-42), Human, mouse/ratEDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (23-42), Human, mouse/ratDVGSNKGAIIGLMVGGVVIA
Beta-Amyloid (1-9), HumanDAEFRHDSG
Beta-Amyloid (1-10), HumanDAEFRHDSGY
Beta-Amyloid (1-11), HumanDAEFRHDSGYE
Beta-Amyloid (1-12), HumanDAEFRHDSGYEV
Beta-Amyloid (1-13), HumanDAEFRHDSGYEVH
Beta-Amyloid (1-15), HumanDAEFRHDSGYEVHHQ
Beta-Amyloid (1-16), HumanDAEFRHDSGYEVHHQK
Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2, HumanDAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
Beta-Amyloid (1-17), HumanDAEFRHDSGYEVHHQKL
Beta-Amyloid (1-17)-Cys, HumanDAEFRHDSGYEVHHQKLC
Beta-Amyloid (1-22), HumanDAEFRHDSGYEVHHQKLVFFAE
Beta-Amyloid (1-33), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Beta-Amyloid (1-34), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Beta-Amyloid (1-36), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
Beta-Amyloid (1-37), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Beta-Amyloid (1-38), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Beta-Amyloid (1-39), HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Beta-Amyloid (3-16), HumanEFRHDSGYEVHHQK
Beta-Amyloid (10-20), HumanYEVHHQKLVFF
Beta-Amyloid (10-26), HumanYEVHHQKLVFFAEDVGS
Beta-Amyloid (10-35)-Lys(Biotin)-NH2, HumanYEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
Beta-Amyloid (11-17), HumanEVHHQKL
Beta-Amyloid (11-22), HumanEVHHQKLVFFAE
Beta-Amyloid (11-25), HumanEVHHQKLVFFAEDVG
Biotin-LC-beta-Amyloid (15-25), Human, mouse/ratBiotin-LC-QKLVFFAEDVG
Beta-Amyloid (16-22), Human, mouse/ratKLVFFAE
Beta-Amyloid (17-24), Human, mouse/ratLVFFAEDV
Beta-Amyloid (22-35), Human, mouse/ratEDVGSNKGAIIGLM
Biotin-LC-beta-Amyloid (22-41), Human, mouse/ratBiotin-LC-EDVGSNKGAIIGLMVGGVVI
Beta-Amyloid (25-35), Human, mouse/ratGSNKGAIIGLM
Angiotensin (1-7)DRVYIHP
Beta-Amyloid (25-35) • HCl, Human, mouse/ratGSNKGAIIGLM • HCl
Beta-Amyloid (25-35), scrambled, Human, mouse/ratMAKGINGISGL
Biotin-beta-Amyloid (25-35), Human, mouse/ratBiotin-GSNKGAIIGLM
Beta-Amyloid (1-28)-Lys(Biotin)-NH2, HumanDAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin) NH2
Angiotensin II, humanDRVYIHPF
Angiotensin II, human, FAM-labeledFAM-DRVYIHPF
Angiotensin II, human, TAMRA-labeledTAMRA-DRVYIHPF
Biotin-LC-Angiotensin IIBiotin-LC-DRVYIHPF
Angiotensin II SubstrateDRV-pY-IHPF
Angiotensin I, humanDRVYIHPFHL
Angiotensin I Converting Enzyme 2, (ACE-2) SubstrateMca-APK(Dnp)
Angiotensin I Converting Enzyme 2, ACE-2/Caspase-1 SubstrateMca-YVADAPK(Dnp)
Angiotensin IIIRVYIHPF
Tetradecapeptide Renin Substrate, Angiotensinogen (1-14), ratDRVYIHPFHLLYYS
Rat Renin Inhibitor Peptide, WFML PeptideAc-HPFV-(Sta)-LF-NH2
Renin 390 FRET Substrate IR-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
Calcitonin Gene Related Peptide, CGRP, humanACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
C-Type Natriuretic Peptide (32-53), human, porcineGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6-22)
BNP-45, mouseSQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23-39)
BNP-32, humanSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Biotin-OxytocinBiotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
Big Endothelin-1 (1-38), humanCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)
Big Endothelin 1 (1-39), porcineCSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
Bactenecin, bovineRLCRIVVIRVCR (Disulfide bridge: 3-11)
Atrial Natriuretic Peptide (4-18), ratRSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
Atrial Natriuretic Peptide (1-28), ratSLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeledBiotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
ApaminCNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11; 3-15)
Atrial Natriuretic Peptide (1-28), human, porcineSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
Amylin (1-37), human, amideKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: 2-7)
Amylin (1-37), humanKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY (Disulfide bridge: 2-7)
Adrenomedullin (1-52), humanYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
[Arg8]-Vasopressin (AVP)CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
α-Calcitonin Gene Related Peptide, α-CGRP, ratSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
Temporin L, amideFVQWFSKFLGRIL-NH2
Temporin A, amideFLPLIGRVLSGIL-NH2
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29RGLRRLGRKIAHGVKKYGPTVLRIIRIAG
rCRAMPGLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
PyrrhocoricinVDKGSYLPRPTPPRPIYNRN
Protegrine-1 (PG-1), amideRGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)
mCRAMP, mouseGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Magainin 2GIGKFLHSAKKFGKAFVGEIMNS
Magainin 1GIGKFLHSAGKFGKAFVGEIMKS
LL17-32FKRIVQRIKDFLRNLV
LL17-29FKRIVQRIKDFLR
LL-37, scrambledGLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
LL-37, reverse sequenceSETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
LL-37, Antimicrobial Peptide, humanLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
LL-37 fragment (18-37), LL-18-37KRIVQRIKDFLRNLVPRTES
LEAP-1, Hepcidin, humanDTHFPICIFCCGCCHRSKCGMCCKT (Disulfide bridges: 7-23, 10-13, 11-19, 14-22)
Lactoferricin B, Lactoferrin (17-41)FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND)
IndolicidinILPWKWPWWPWRR-NH2
Human Lactotransferrin (37-61), Lactoferricin HTKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
Histatin-5DSHAKRHHGYKRKFHEKHHSHRGY
HEL (46-61)NTDGSTDYGILQINSR
DrosocinGKPRPYSPRPTSHPRPIRV
Dermcidin, DCD-1LSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Cys-LC-LL-37C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
CSP-2, Competence-Stimulating Peptide-2EMRISRIILDFLFLRKK
Cecropin BKWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
ElafinAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23-Cys49, Cys32-Cys44, Cys38-Cys53)
Cecropin AKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
CAP-18, rabbitGLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Biotin-LC-LL-37Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Bac2A; Bactenecin 2ARLARIVVIRVAR-NH2
Apidaecin IBGNNRPVYIPQPRPPHPRL
5-FAM-LC-LL-375-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
β-CGRP, humanACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
[Ala13]-Apelin-13QRPRLSHKGPMPA
[Des-Arg10]-HOE I40rRP-Hyp-G-Thi-S-(D-Tic)-Oic
[Des-Pro2]-Bradykinin; Angiotensin I Converting Enzyme (ACE I) InhibitorRPPGFSPFR
[Lys0]-Bradykinin (Kallidin)KRPPGFSPFR
[Lys8,9]-Neurotensin (8-13)KKPYIL
[Pyr1]-Apelin-13Pyr-RPRLSHKGPMPF-OH
Apelin 12RPRLSHKGPMPF
Apelin-16, human, bovineFRRQRPRLSHKGPMPF
Apelin-36, humanLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Biotin-a-CGRP, humanBiotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
Biotin-BradykininBiotin-RPPGFSPFR
BNP-45 (51-95), rat, 5K Cardiac Natriuretic PeptideSQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Calcitonin Gene Related Peptide, CGRP (8-37), humanVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
EMP17, FITC-LC labeledFITC-LC-TYSCHFGPLTWVCKPQGG
Endothelin 1, human, FAM-labeledFAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
Endothelin 1, human, porcineCSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
Endothelin 3, human, ratCTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1-15 and 3-11)
Erythropoietin-Mimetic Peptide 17 (EMP17)TYSCHFGPLTWVCKPQGG
Fibrinogen Binding Inhibitor PeptideHHLGGAKQAGDV
Fibrinolysis Inhibiting FactorGPRP
Fibrinopeptide A, humanADSGEGDFLAEGGGVR
Fibrinopeptide B, humanPyr-GVNDNEEGFFSAR
FRETS - VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)DRE-Dap(Nma)-APNLVYMVTG-Dpa-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Gamma - Fibrinogen (377-395)YSMKETTMKIIPFNRLSIG
Gamma - Fibrinogen (377-395), scrambledKMMISYTFPIERTGLISNK
H-D-Phe-Pro-Arg-AFCfPR-AFC
H-D-Val-Leu-Lys-AFCvLK-AFC
Hirudin (54-65), sulfatedAc-GDFEEIPEE-Y(SO3H)-LQ
HOE I40rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
LSKL, Inhibitor of Thrombospondin (TSP-1)LSKL-NH2
NeurotensinPyr-LYENKPRRPYIL
Neurotensin (8-13)RRPYIL
Proadrenomedullin N - terminal 20 peptide, PAMP (1-20)ARLDVASEFRKKWNKWALSR-NH2
Protease-Activated Receptor-1, PAR-1 AgonistTFLLRN
Protease-Activated Receptor-1, PAR-1 Agonist, amideAF(para-Fluoro)R-Cha-Cit-Y-NH2
Protease-Activated Receptor-1, PAR-1 AntagonistYFLLRNP-OH
Protease-Activated Receptor-1, PAR-1 Antagonist, amideS-F(para-Fluoro)-Aad-LRNP-NH2
Protease-Activated Receptor-2, PAR-2 Agonist, amide2-Furoyl-LIGRLO-NH2
Protease-Activated Receptor-2, PAR-2 Agonist, amideSLIGKV-NH2
Protease-Activated Receptor-3 (1-6), PAR-3 (1-6), humanTFRGAP-NH2
Protease-Activated Receptor-3, PAR-3 Agonist, amideSFNGGP-NH2
Protease-Activated Receptor-4, PAR-4 Agonist, amideAYPGKF-NH2
Protease-Activated Receptor-4, PAR-4 Agonist, amide, murineGYPGKF-NH2
Protease-Activated Receptor-4, PAR-4 Antagonist, amidetrans-Cinnamoyl-YPGKF-NH2
RYR2 (2460-2495)GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Uroguanylin (Rat)TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15
VIP (1-12), human, porcine, ratHSDAVFTDNYTR
VIP, human, porcine, ratHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
VIP, human, porcine, rat, FAM-labeledFAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
WP9QY, TNF-alpha AntagonistYCWSQYLCY (Disulfide bridge: 2-8)
Linear C5a Receptor Antagonist, human, ratFKP-(D-Cha)-Wr
C5a Receptor Agonist, mouse, humanFKP-(D-Cha)-Cha-r
BMAP-18GRFKRFRKKFKKLFKKLS
BMAP-27GRFKRFRKKFKKLFKKLSPVIPLLHLG
NRC-16GWKKWLRKGAKHLGQAAIK
PMAP-23RIIDLLWRVRRPQKPKFVTVWVR
Rev4RRWPWWPWKWPLI
SMAP-18RGLRRLGRKIAHGVKKYG-NH2
Tet-20KRWRIRVRVIRKC
Bax BH3 peptide (55-74), wild typeSTKKLSECLKRIGDELDSNM
Biotin-Caspase 1 Inhibitor IIBiotin-YVAD-CMK
Caspase 1 (ICE) Substrate 2, chromogenicAc-YVAD-pNA
Caspase 1 (ICE) Substrate 3f, fluorogenicAc-WEHD-AFC
Caspase 1 Inhibitor IIAc-YVAD-CMK
Caspase 3 (Apopain) Substrate 1, chromogenicAc-DEVD-pNA
Caspase 3 (Apopain) Substrate 1f, fluorogenicAc-DEVD-AFC
Caspase 3 (Apopain) Substrate 1m, fluorogenicAc-DEVD-AMC
Caspase 3 (Apopain) Substrate 1r-z, fluorogenic(Z-DEVD)2-Rh110
Caspase 8 Substrate 1, chromogenicAc-IETD-pNA
Caspase 8 Substrate 1f, fluorogenicAc-IETD-AFC
Caspase 9 Substrate 1, chromogenicAc-LEHD-pNA
Caspase 9 Substrate 1f, fluorogenicAc-LEHD-AFC
Pro-apoptotic Peptide, klaklakklaklak, 5-FAM-labeled5-FAM-klaklakklaklak-NH2
Proapoptotic Peptide, (klaklak)2klaklakklaklak-NH2
PUMA BH3EEQWAREIGAQLRRMADDLNAQYER
Smac/Diablo Peptide [AVPIAQKSE], 5-FAM labeledAVPIAQKSEK-K(5-FAM)-NH2
26Rfa, Hypothalamic Peptide, humanTSGPLGNLAEELNGYSRKKGGFSFRF-NH2
26Rfa, Hypothalamic Peptide, ratASGPLGTLAEELSSYSRRKGGFSFRF-NH2
CRAMP1-39ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Listeria monocytogenes Listeriolysin O; LLO (91-99)GYKDGNEYI
Bacterial Sortase Substrate I, FRETDABCYL-LPETG-EDANS
Bacterial Sortase Substrate II , Dabcyl/EdansDabcyl-QALPETGEE-Edans
Bacterial Sortase Substrate III, Abz/DNPAbz-LPETG-K(Dnp)-NH2
CFP10 (71-85)EISTNIRQAGVQYSR
CSP-1, Competence Stimulating Peptide-1EMRLSKFFRDFILQRKK
flg22, Flagellin FragmentQRLSTGSRINSAKDDAAGLQIA
HCAM-26-FAM-VFDAVTDVIIKNNLKECGLY
SPase I FRET SubstrateDabcyl-AGHDAHASET-Edans
Staphylococcal Enterotoxin B Domain (SEB) (144-153)KKKVTAQELD
bFGF (119-126), Basic Fibroblast Growth Factor, human, bovineKRTGQYKL
BAD (103-127), humanNLWAAQRYGRELRRMSDEFVDSFKK
BAD (103-127), human, FAM-labeledFAM-NLWAAQRYGRELRRMSDEFVDSFKK
Noxa BH3, Peptide 1PAELEVECATQLRRFGDKLNFRQKLL
[D-Tyr6, β-Ala11, Phe13, Nle14]-Bombesin (6-14)yQWAV-(ß-A)-HF-Nle-NH2
[Lys3]-BombesinPyr-QKLGNQWAVGHLM-NH2
C-peptide (57-87), humanEAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
C-peptide, dogEVEDLQVRDVELAGAPGEGGLQPLALEGALQ
C-Peptide-1, ratEVEDPQVPQLELGGGPEAGDLQTLALEVARQ
C-Peptide-2, ratEVEDPQVAQLELGGGPGAGDLQTLALEVARQ
Proinsulin C-Peptide (31-63), porcineRREAENPQAGAVELGGGLGGLQALALEGPPQKR
Proinsulin C-peptide (55-89), humanRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR
[Trp63, 64]-C3a (63-77)WWGKKYRASKLGLAR
C3a (70-77)ASHLGLAR
Calcitonin, humanCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Calcitonin, salmonCSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
[Asp370]-Tyrosinase (368-376)YMDGTMSQV
AH1 Sequence (6-14)SPSYVYHQF
Bak BH3GQVGRQLAIIGDDINR
Bak BH3 peptide, TAMRA-labeled5-TAMRA-GQVGRQLAIIGDDINR
Bcl-2 Binding Peptide, Bad BH3 PeptideLWAAQRYGRELRRMSDEFEGSFKGL
Bid BH3 PeptideEDIIRNIARHLAQVGDSMDR
Bid BH3, FAM labeled5-FAM-EDIIRNIARHLAQVGDSMDR
Bid BH3-r8rrrrrrrr-GEDIIRNIARHLAQVGDSMDR
Bim BH3, Peptide IIIDMRPEIWIAQELRRIGDEFNAYYAR
Bim BH3, Peptide IVDMRPEIWIAQELRRIGDEFNAYYARR
c-Myc peptide epitopeEQKLISEEDL
Enhanced Green Fluorescent Protein, EGFP (200-208)HYLSTQSAL
G209-2M, gp100 (209-217)IMDQVPFSV
GAD65 (206-220)TYEIAPVFVLLEYVT
gp100 (25-33), humanKVPRNQDWL
HIF-1 {alpha} (556-574)DLDLEMLAPYIPMDDDFQL
Kisspeptin-10 (Kp-10), Metastin (110-119), amide, mouse, ratYNWNSFGLRY-NH2
Kisspeptin-10 (Kp-10), Metastin (45-54)YNWNSFGLRF-NH2
LyP-1, Peptide 1CGNKRTRGC (S-S Bonded)
MAGE-3 (271-279)FLWGPRALV
MUC1, tandem repeat fragmentPDTRPAPGSTAPPAHGVTSA
MUC5AC, Analog 1GTTPSPVPTTSTTSAP
MUC5AC 3GT-T*-PSPVPTTSTTSAP
MUC5AC-13GTTPSPVPTTST-T*-SAP
MUC5AC-3/13GT-T*-PSPVPTTST-T*-SAP
Noxa A BH3 peptide, cell permeablerrrrrrrrGAELPPEFAAQLRKIGDKVYC
Nuclear Factor (Erythroid-derived 2)like 2 (74-87); Nrf2 (74-87); NFE2L2 (74-87)LQLDEETGEFLPIQ
Shepherdin (79-87)KHSSGCAFL
Thrombospondin-derived Peptide; Cyclic CSVTCGCSVTCG (S-S Bonded)
TRP-2 (180-188)SVYDFFVWL
TRP-2, Tyrosinase-related Protein 2 (181-188)VYDFFVWL
VEGFR2/KDR AntagonistATWLPPR
β-Casomorphin (1-7), bovineYPFPGPI
CEF1, Influenza Matrix Protein M1 (58-66)GILGFVFTL
CEF2, Influenza Virus PA (46-54)FMYSDFHFI
CEF8, Influenza Virus NP (383-391)SRYWAIRTR
CEF10, Epstein-Barr Virus LMP2 (426-434)CLGGLLTMV
CEF11, Epstein-Barr Virus BMLF1 (280-288)GLCTLVAML
CEF19, Epstein-Barr Virus latent NA-3A (458-466)YPLHEQHGM
CEF20, Cytomegalovirus, CMV pp65 (495-503)NLVPMVATV
CEF25, Influenza Virus NP (44-52)CTELKLSDY
CEF26, Influenza Virus NP (265-274)ILRGSVAHK
CEF30, Epstein-Barr Virus BRLF1 (134-142)ATIGTAMYK
37,43Gap 27, Connexin MimeticSRPTEKTIFII
37, 40 GAP26, Connexin MimeticVCYDQAFPISHIR
40Gap 27, Connexin MimeticSRPTEKNVFIV
43Gap 26, Connexin MimeticVCYDKSFPISHVR
4N1KKRFYVVMWKK
Cell Adhesive Peptide [RGDC]RGDC
FN-A208 Fusion PeptideGRGDSGAASIKVAVSADR
Gap 27, scrambledREKIITSFIPT
Hyaluronan InhibitorGAHWQFNALTVR
Hyaluronan-Binding Peptide, biotin labeledGAHWQFNALTVRGGGS-K(Biotin)
Vitronectin (367-378)GKKQRFRHRNRKG
(Arg)9RRRRRRRRR
(Arg)9 biotin labeledBiotin-LC-RRRRRRRRR-NH2
(Arg)9, FAM-labeledFAM-RRRRRRRRR
(Arg)9, TAMRA-labeledTAMRA-RRRRRRRRR
Antennapedia Peptide, acidRQIKIWFQNRRMKWKK
Antennapedia Peptide, FAM-labeled5-FAM-RQIKIWFQNRRMKWKK-NH2
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
Biotin-TAT (47-57)Biotin-YGRKKRRQRRR
BuforinTRSSRAGLQFPVGRVHRLLRK
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Cys(Npys) Antennapedia Peptide, amideC(Npys)-RQIKIWFQNRRMKWKK-NH2
Cys(Npys)-(Arg)9C(Npys)RRRRRRRRR-NH2
Cys(Npys)-(D-Arg)9C(Npys)rrrrrrrrr-NH2
Cys(Npys)-TAT (47-57)C(Npys)YGRKKRRQRRR-NH2
Cys(Npys)-TAT (47-57), FAM-labeledC(Npys)YGRKKRRQRRR-K(FAM)-NH2
Cys-TAT (47-57)CYGRKKRRQRRR-NH2
FITC-LC-Antennapedia PeptideFITC-LC-RQIKIWFQNRRMKWKK-NH2
FITC-LC-TAT (47-57)FITC-LC-YGRKKRRQRRR-NH2
HIV-1 Tat (48-60)GRKKRRQRRRPPQ
KALAWEAKLAKALAKALAKHLAKALAKALKACEA
MastoparanINLKALAALAKKIL-NH2
NGR Peptide 1CNGRCGGklaklakklaklak-NH2 (Disulfide bridge: 1-5)
PenetratinRQIKIWFQNRRMKWKKGG
Penetratin-ArgRQIRIWFQNRRMRWRR
Pep-1-CysteamineAc-KETWWETWWTEWSQPKKKRKV-cysteamine
Pep-1: Chariot (Non-Covalent Delivery of Peptides and Proteins)KETWWETWWTEWSQPKKKRKV
pVEC (Cadherin-5)LLIILRRRIRKQAHAHSK
Rabies Virus Glycoprotein (RVG)YTIWMPENPRPGTPCDIFTNSRGKRASNG
SV-40 Large T-antigen Nuclear Localization Signal (NLS)CGGGPKKKRKVED
SV40 T-Ag-derived Nuclear Localization Signal (NLS) PeptidePKKKRKVEDPYC
TAT (47-57)YGRKKRRQRRR
TAT (47-57) GGG-Cys(Npys)YGRKKRRQRRRGGG-C(Npys)-NH2
TAT (47-57), FAM-labeledFAM-YGRKKRRQRRR
TAT (47-57), TAMRA-labeledTAMRA-YGRKKRRQRRR
Tat-Beclin-1YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Tat-Beclin-1, scrambledYGRKKRRQRRRGGVGNDFFINHETTGFATEW
Tat-C (48-57)CGRKKRRQRRR
TAT-GluR23A Fusion PeptideYGRKKRRQRRRAKEGANVAG
Tat-GluR23YYGRKKRRQRRRYKEGYNVYG
Tat-GluR23Y, scrambledYGRKKRRQRRRVYKYGGYNE
TAT-HA2 Fusion PeptideRRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Tat-NR2BctYGRKKRRQRRRKLSSIESDV
TAT-NSF222 Fusion PeptideYGRKKRRQRRR-GGG LDKEFNSIFRRAFASRVFPPE
TAT-NSF222scr Fusion Polypeptide, scrambledYGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
TAT-NSF700 Fusion PeptideYGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
TAT-NSF700scrYGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
TfR Targeting PeptideTHRPPMWSPVWP
Transdermal PeptideACSSSPSKHCG
TransportanGWTLNSAGYLLGKINLKALAALAKKIL
Chemerin (149-157)YFPGQFAFS
[Thr28, Nle31]-Cholecystokinin (25-33), sulfatedRD-Y(SO3H)-TGW-Nle-DF-NH2
CaeruleinPyr-QD-Y(SO3H)-TGWMDF-NH2
Cholecystokinin (26-33), CCK Octapeptide, CCK-8, sulfatedD-Y(SO3H)-MGWMDF-NH2
Cholecystokinin (26-33), CCK8DYMGWMDF-NH2
Angiotensin I, human, 13C and 15N-labeledDRVY-I*-HPFHL [I*=I(U13C6,15N)]
Angiotensin I, human, 13C and 15N labeledDR-V*-Y-I*-HPFHL [Val*=Val(U-13C5,15N); Ile*=Ile(U-13C6,15N)]
Angiotensin II, human, 13C and 15N-labeledDRVY-I*-HPF [I*=I(U13C6,15N)]
beta-Amyloid (1-38), 13C-Phe & Ile, HumanDAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U - 13C9), *I=Ile(U-13C6)
beta-Amyloid (1-40), 13C,15N-labeled at Arg & Lys, HumanDAEF - R* - HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV [R*=R(U-13C6, U-15N4) & K*=K(U-13C6, U-15N2)]
beta-Amyloid (1-42), 13C, 15N-labeled at Arg & Lys, HumanDAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVVIA [R*=R(U-13C6, U-15N4) & K*=K(U-13C6, U-15N2)]
BSA (347-359), Isotopic labeled, Mass Spec StandardDAF-L*-GSF-L*-YEYSR [L*=L(U13C6, 15N)]
Biotin-Corticotropin Releasing Factor, Biotin - CRF, human, ratBiotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Corticotropin Releasing Factor, CRF, human, ratSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Corticotropin Releasing Factor, CRF, ovineSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
(Biotin-LC)-SARS-CoV-2 Spike RBM (receptor binding motif), 438-458Biotin-LC-SNNLDSKVGGNYNYLYRLFRK
Spike glycoprotein from SARS-CoV-2Spike glycoprotein from SARS-CoV-2
DX 600, ACE2 InhibitorAc-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 319-335RVQPTESIVRFPNITNL
SARS - CoV - 2 Spike RBD (receptor binding domain), 319-335-Lys(Biotin-LC)RVQPTESIVRFPNITNL-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 336-347CPFGEVFNATRF
SARS - CoV - 2 Spike RBD (receptor binding domain), 336-347-Lys(Biotin-LC)CPFGEVFNATRF-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 348-357ASVYAWNRKR
SARS - CoV - 2 Spike RBD (receptor binding domain), 348-357-Lys(Biotin-LC)ASVYAWNRKR-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 352-365AWNRKRISNCVADY
SARS - CoV - 2 Spike RBD (receptor binding domain), 352-365-Lys(Biotin-LC)AWNRKRISNCVADY-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 371-394SASFSTFKCYGVSPTKLNDLCFTN
SARS-CoV-2 Spike RBD (receptor binding domain), 371-394-Lys(Biotin-LC)SASFSTFKCYGVSPTKLNDLCFTN-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 395-430VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT
SARS-CoV-2 Spike RBD (receptor binding domain), 395-430-Lys(Biotin-LC)VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 513-520LSFELLHA
SARS-CoV-2 Spike RBD (receptor binding domain), 513-520-Lys(Biotin-LC)LSFELLHA-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBD (receptor binding domain), 523-541TVCGPKKSTNLVKNKCVNF
SARS-CoV-2 Spike RBD (receptor binding domain), 523-541-Lys(Biotin-LC)TVCGPKKSTNLVKNKCVNF-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBM (receptor binding motif), 438-458SNNLDSKVGGNYNYLYRLFRK
SARS-CoV-2 Spike RBM (receptor binding motif), 450-473NYLYRLFRKSNLKPFERDISTEIY
SARS-CoV-2 Spike RBM (receptor binding motif), 450-473-Lys(Biotin-LC)NYLYRLFRKSNLKPFERDISTEIY-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBM (receptor binding motif), 480-496CNGVEGFNCYFPLQSYG
SARS - CoV - 2 Spike RBM (receptor binding motif), 480-496-Lys(Biotin-LC)CNGVEGFNCYFPLQSYG-K(Biotin-LC)-NH2
SARS-CoV-2 Spike RBM (receptor binding motif), 500-509TNGVGYQPYR
SARS-CoV-2 Spike RBM (receptor binding motif), 500-509-Lys(Biotin-LC)TNGVGYQPYR-K(Biotin-LC)-NH2
Cyclo (-GRGDSP)GRGDSP, N to C cyclized
Cyclo (-RADfK-), RGD negative controlCyclo(-RADfK-)
Cyclo (-RGDyK)Cyclo(-RGDyK)
Cyclo (RGDfC), avb3 Integrin Binding Cyclic RGD PeptideCyclo(-RGDfC)
Cyclo-[GRGESP]Cyclo-[GRGESP]
Cyclo[-RGDy-K(5-FAM)]Cyclo[-RGDy-K(5-FAM)]
Aminopeptidase N Ligand (CD13), NGR peptideCNGRCG (Disulfide bridge: 1-5)
hBD-1, β-Defensin-1, humanDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
CharybdotoxinPyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
Chlorotoxin (Cltx)MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
hBD-3, β-Defensin-3, humanGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
HNP-1, Defensin Human Neutrophil Peptide-1ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
HNP-2, Defensin Human Neutrophil Peptide-2CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
Iberiotoxin (IbTX)Pyr-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: C7-C28,C13-C33,C17-C35)
Orexin A, bovine, human, mouse, ratPyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
RGD-4CACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
Somatostatin 14, human, rat, mouse, pig, chicken, frogAGCKNFFWKTFTSC (Disulfide bridge: 3-14)
Somatostatin 28, human, sheep, cow, rat, mouse, pigSANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
MCC (88-103)ANERADLIAYLKQATK
PCC (88-104)KAERADLIAYLKQATAK
CHRG01; Human β-Defensin 3 (hBD3) DerivativeKSSTRGRKSSRRKK
Deltorphin AYmFHLMD-NH2
Deltorphin BYaFEVVG-NH2
[FAM-Trp31]-GLP-1 (7-36), Fluorescent label at Trp31HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
BDC2.5 MimotopeRTRPLWVRME
Biotin-Exendin 4Biotin - HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Biotin-Glucagon (1-29), bovine, human, porcineBiotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Biotin-Glucagon-Like Peptide 1, GLP-1 (7-36), amide, humanBiotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Exendin (5-39)TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin (9-39)DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin 4HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin 4, FAM-labeledFAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Fluorescein-Trp25-Exendin-4 (FLEX)HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2
GIP (1-42), humanYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
GIP (3-42), humanEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
GIP, ratYAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
GLP-1(9-36), amide, humanEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), humanHADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Glucagon (1-29), bovine, human, porcineHSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Glucagon (1-29), bovine, human, porcine, FAM-labeledFAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Glucagon (1-37), Oxyntomodulin, porcineHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Glucagon-Like Peptide 1, GLP-1 (7-36), amide, humanHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, humanHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
Glucagon-Like Peptide 1, GLP-1 (7-37)HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Glucagon-Like Peptide 1, GLP-1 amide, humanHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeledFAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
IGRP Catalytic Subunit-related Protein (206-214)VYLKTNVFL
Insulin β Chain Peptide (15-23)LYLVCGERG
Insulin B (9-23)SHLVEALYLVCGERG
Pancreatic Polypeptide, humanAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Peptide YY (3-36), humanIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Peptide YY, humanYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Trp CageNLYIQWLKDGGPSSGRPPPS
Biotin-Dynorphin A (1-17)Biotin-YGGFLRRIRPKLKWDNQ
Dynorphin A (1-17)YGGFLRRIRPKLKWDNQ
Dynorphin A (1-8), porcineYGGFLRRI
β-Endorphin, humanYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Autocamtide-2-Related Inhibitory Peptide (AIP); CaMKII Inhibitor, myristoylatedMyr-KKALRRQEAVDAL
Autocamtide-3 Derived Inhibitory Peptide(AC3-I); CaMKII Inhibitor, myristoylatedMyr-KKALHRQEAVDAL
Calpain Substrate, Fluorogenic(Z-AA)2Rh110
Cathepsin S SubstrateAc-KQKLR-AMC
delta PKC (8-17); PKC d InhibitorSFNSYELGSL
Elastase Substrate, fluorogenic(Z-AAAA)2Rh110
Elastase/Trypsin Substrate, fluorogenic(Z-AR)2Rh110•HCl
Enterokinase SubstrateGDDDDK-βNA
gp91 ds-tatYGRKKRRQRRRCSTRIRRQL-NH2
gp91 ds-tat Peptide 2RKKRRQRRRCSTRIRRQL-NH2
gp91 ds-tat Peptide 2; sgp91 ds-tat Peptide 2, scrambledRKKRRQRRRCLRITRQSR-NH2
gp91 ds-tat, FAM labeled5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2
gp91 ds-tat; sgp91 ds-tat, scrambledYGRKKRRQRRRCLRITRQSR-NH2
IRAK-1 (360-380); IRAK-4 Peptide SubstrateKKARFSRFAGSSPSQSSMVAR
Mucin 10 (153-165), EA2PTTDSTTPAPTTK
O-linked GlcNAc transferase (OGT) SubstrateKKKYPGGSTPVSSANMM
Proteases Substrate, Fluorogenic(Z-R)2Rh110 • 2HCl
S2238, Thrombin Substratef-Pip-R-pNA
α1(I) Collagen (614-639), Type I Collagen α1(I) C-Telopeptide, humanSAGFDFSFLPQPPQEKAHDGGRYYRA
Laminin α1 (2110-2127), amide, mouseCSRARKQAASIKVAVSADR-NH2
[Glu1]-Fibrinopeptide BGlufib
[Glu3]-RGES, Control for RGD PeptidesRGES
GRGDS, amideGRGDS-NH2
GRGDS, LC-biotin labeledBiotin-LC-GRGDS
Integrin Binding PeptideAc-GCGYGRGDSPG-NH2
390 MMP FRET Substrate IMca-PLGL-Dpa-AR-NH2
2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYLEDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH
390 MMP FRET Substrate IIMca-PLGL-Dpa-AR
390 MMP FRET Substrate IVMca-P-Cha-G-Nva-HA-Dpa-NH2
390 MMP FRET Substrate VMca-PLGLEEA-Dpa-NH2
490 MMP FRET Substrate IIIDABCYL-RPLALWRS-EDANS
5-FAM MMP FRET Peptide Fluorescence Standard I5-FAM-PL
5-FAM-PMDM6 (PMDM6-F)5-FAM-(β-A)-(β-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
Abltide, TAMRA-labeled5-TAMRA-KKGEAIYAAPFA-NH2
Cls Substrate, C2 (Abz/Dnp)2Abz-SLGRKIQIK(Dnp)-NH2
CREBtide [KRREILSRRPSYR], 5-FAM labeled5-FAM-KRREILSRRPSYR
Crosstide [GRPRTSSFAEG], 5-FAM labeled5-FAM-GRPRTSSFAEG
CSK tide, FAM labeled5-FAM-KKKKEEIYFFFG-NH2
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], 5-FAM labeled5-FAM-DADE-pY-LIPQQG
HCV Protease FRET Substrate (RET S1)Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
Histone H1-derived Peptide, FAM-labeled5-FAM-GGGPATPKKAKKL
Histone H3 (1-21), K4 methylated, FAM labeledART-K(Me)-QTARKSTGGKAPRKQLAGG-K(FAM)-NH2
HIV Protease FRET Substrate IDABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS
Kemptide [LRRASLG], 5-FAM labeled5-FAM-LRRASLG
MMP Colorimetric Substrate IAc-PLG-SCH[CH2CH(CH3)2]-CO-LG-OC2H5
NFF-3Mca-RPKPVE-Nva-WR-K(Dnp)-NH2
p53 (17-26), FITC labeledFITC-LC-ETFSDLWKLL-NH2
SAM PEP 1, FAM labeled; AMPK substrate peptide, FAM labeled5-FAM-HMRSAMSGLHLVKRR
Substance P, FAM-labeledFAM-RPKPQQFFGLM-NH2
TNO211DABCYL-(γ-Abu)-PQGL-E(EDANS)AK-NH2
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5-TMR labeled5-TMR-KVEKIGEGTYGVVYK
WAAG-3R, Aggrecanase (ADAM-TS-4) FRET SubstrateAbz-TEGEARGSVI-Dpa-KK-NH2
Galanin, humanGWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
(Leu15)-Gastrin-1, humanPyr-GPWLEEEEEAYGWLDF-NH2
Big Gastrin-1, humanPyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
Biotin-Gastrin (1-17)Biotin-EGPWLEEEEEAYGWMDF-NH2
Gastrin Releasing Peptide, humanVPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Gastrin-1, humanPyr-GPWLEEEEEAYGWMDF-NH2
Gastrin-1, ratPyr-RPPMEEEEEAYGWMDF-NH2
Leptin (93-105), humanNVIQISNDLENLR
[Des-octanoyl]-Ghrelin, humanGSSFLSPEHQRVQQRKESKKPPAKLQPR
[Des-octanoyl]-Ghrelin, rat, mouseGSSFLSPEHQKAQQRKESKKPPAKLQPR
Biotin-Ghrelin, humanBiotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
Ghrelin, humanGS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
Ghrelin, rat, mouseGS-S(n-octanoyl)-FLSPEHQKAQQRKESKKPPAKLQPR
α-Gliadin (31-43)LGQQQPFPPQQPY
α9-Gliadin (57-68)QLQPFPQPQLPY
α-Mating Factor Pheromone, yeastWHWLQLKPGQPMY
Adrenomedullin (22-52), humanTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
[Leu31, Pro34]-Neuropeptide Y, human, ratYPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
Neuropeptide Y, human, ratYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
OxytocinCYIQNCPLG-NH2 (Disulfide bridge: 1-6)
Biotin-PACAP (1-38), amide, human, ovine, ratBiotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
PACAP (1-27), amide, human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
PACAP (1-38), amide, human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
PACAP (1-38)-Lys(Biotin), amide, human, ovine, ratHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
PACAP (6-38), amide, human, ovine, ratFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Secretin, ratHSDGTFTSELSRLQDSARLQRLLQGLV-NH2
[Succinyl-Asp6, NMePhe8]-Substance P (6-11), SenktideSuc-DF-(NMeF)-GLM-NH2
Substance PRPKPQQFFGLM-NH2
BMP-2 Knuckle Epitope (73-92)KIPKASSVPTELSAISTLYL
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], BiotinylatedBiotin-DADE-pY-LIPQQG
EGFR Protein Tyrosine Kinase SubstrateADEYLIPQQ
Growth Hormone Releasing Factor, GRF (1-29), amide, humanYADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Hepatitis Virus C NS3 Protease Inhibitor 2Ac-DE-Dif-E-Cha-C
PEP1SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Histone H1-derived PeptideGGGPATPKKAKKL
Histone H2A (1-20)SGRGKQGGKARAKAKTRSSR
Histone H2A (1-20)-GGK(Biotin); biotin-labeledSGRGKQGGKARAKAKTRSSRGG-K(Biotin)
Histone H2A (1-22)-GK(Biotin)SGRGKQGGKARAKAKSRSSRAG-GK(Biotin)-NH2
Histone H2B (21-41), biotin labeledAQKKDGKKRKRSRKESYSIYVGG-K(Biotin)
Histone H3 (1-8)ARTKQTAR
Histone H3 (73-83)EIAQDFKTDLR
[Lys(Me3)79]-Histone H3(73-83), H3K79(Me3)EIAQDF-K(Me3)-TDLR
[Lys(Ac)79]-Histone H3 (69-89), H3K79(Ac), biotin-labeledRLVREIAQDF-K(Ac)-TDLRFQSSAV-K(biotin)
[Lys(Me1)27/36]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1)K36(Me1)ATKAAR-K(Me1)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
[Lys(Me2)27, Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2)K36(Me1), biotin-labeledATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPGG-K(Biotin)
[Lys(Me1)4]-Histone H3 (1-10), H3K4(Me1)ART-K(Me1)-QTARKS
[Lys(Me2)4]-Histone H3 (1-10), H3K4(Me2)ART-K(Me2)-QTARKS
[Lys(Me3)4]-Histone H3 (1-10), H3K4(Me3)ART-K(Me3)-QTARKS
[Lys(Ac)14]-Histone H3 (1-19),H3K14(Ac)ARTKQTARKSTGG-K(Ac)-APRKQ
Histone H3 (1-20), N-TerminalARTKQTARKSTGGKAPRKQL
[Lys(Ac)9]-Histone H3 (1-20), H3K9(Ac)ARTKQTAR-K(Ac)-STGGKAPRKQL
Histone H3 (1-21), BiotinylatedARTKQTARKSTGGKAPRKQLA-GG-K(BIOTIN)-NH2
Histone H3 (1-21), FAM labeledARTKQTARKSTGGKAPRKQLAGG-K(FAM)-NH2
Histone H3 (1-21), N-TerminalARTKQTARKSTGGKAPRKQLA
[Cit 2/8/17]-Histone H3 (1-21)-GGK(Biotin), amideA-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLAGG-K(Biotin)-NH2
[Lys(Ac)4]-Histone H3 (1-21)-GGK(Biotin)ART-K(Ac)-QTARKSTGGKAPRKQLAGG-K(biotin)
[Lys(Me1)4]-Histone H3 (1-21), H3K4(Me1)ART-K(Me1)-QTARKSTGGKAPRKQLA
[Lys(Me2)4]-Histone H3 (1-21), H3K4(Me2)ART-K(Me2)-QTARKSTGGKAPRKQLA
[Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3)ART-K(Me3)-QTARKSTGGKAPRKQLA
[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), biotin labeledART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
[Lys(Me1)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me1), biotin-labeledART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(Biotin)
[Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me2), biotin-labeledART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin)
[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), biotin-labeledART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)
[Lys (Me3)4, Lys (Ac)9, pSer10]-Histone H3 (1-21)ART-K(Me3)-QTAR-K(Ac)-pS-TGGKAPRKQLA
[Arg(Me1)8]-Histone H3 (1-21)-K(Biotin), H3R8(Me1), biotin labeledARTKQTA-R(Me1)-KSTGGKAPRKQLA-K(Biotin)-NH2
[Arg(Me2a)8]-Histone H3(1-21)-K(Biotin), H3R8(Me2a), biotin-labeledARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
[Arg(Me2s)8]-Histone H3 (1-21), biotin-labeledARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)
[Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac)ARTKQTAR-K(Ac)-STGGKAPRKQLA
[Lys(Ac)9]-Histone H3 (1-21)-NH2, H3K9(Ac), biotin-labeled, amideARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2
[Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Ac), biotin-labeledARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)
[Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin), H3K9/14(Ac), biotin-labeledARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin)
[Lys(Me1)9]-Histone H3 (1-21), biotin-labeledARTKQTAR-K(Me1)-STGGKAPRKQLA-K(Biotin)
[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeledARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)
[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin); H3K9(Me1), biotin-labeled, amideARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2
[Lys(Me2)9]-Histone H3 (1-21)ARTKQTAR-K(Me2)-STGGKAPRKQLA
[Lys(Me2)9]-Histone H3 (1-21)-K(Biotin), H3K9(Me2), biotin labeledARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin)
[Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeledARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)
[Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeled, amideARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)-NH2
[Lys(Me3)9]-Histone H3 (1-21), H3K9(Me3)ARTKQTAR-K(Me3)-STGGKAPRKQLA
[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeledARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)
[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, amideARTKQTAR-K(Me3)-STGGKAPRKQLAGG-K(Biotin)-NH2
[pSer10]-Histone H3 (1-21)-GGK(Biotin); H3pS10, biotin-labeledARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2
[pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeledARTKQTARK-pS-TGG-K(Ac)-APRKQLAGGK(Biotin)
[pThr11]-Histone H3(1-21)-GGK(Biotin), H3pT11, biotin-labeledARTKQTARKS-pT-GGKAPRKQLAGG-K(Biotin)-NH2
[Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), H3K14(Ac), biotin-labeledARTKQTARKSTGG-K(Ac)-APRKQLA-GGK(Biotin)
[Arg(Me1)17]-Histone H3 (1-21)-GGK(Biotin), H3R17(Me1), biotin-labeledARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2
[Cit17]-Histone H3 (1-21)-GGK(Biotin)ARTKQTARKSTGGKAP-Cit-KQLAGG-K(Biotin)
[Lys(Ac)18]-Histone 3 (1-21)-GGK(Biotin); H3K18(Ac), biotin-labeledARTKQTARKSTGGKAPR-K(Ac)-QLA-GGK(Biotin)-NH2
[Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me1), biotin-labeledARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2
[Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me2), biotin-labeledARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2
[Lys(Ac)9]-Histone H3 (1-24), H3K9(Ac)ARTKQTAR-K(Ac)-STGGKAPRKQLATKA
[Lys(Ac)14/18/23]-Histone H3 (1-24)-GGK(Biotin)ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AGG-K(Biotin)
Histone H3 (1-25), amideARTKQTARKSTGGKAPRKQLATKAA-NH2
[Lys(Me3)4]-Histone H3 (1-25); H3K4(Me3)ART-K(Me3)-QTARKSTGGKAPRKQLATKAA-NH2
[Lys(Ac)14/18/23/27]-Histone H3 (1-30)-GGK(Biotin)ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG-K(Biotin)
Histone H3(1-35)ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
Histone H3 (1-50)-GGK(Biotin), biotin-labeledARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG-K(Biotin)
[Lys(Me1)9]-Histone H3 (3-17), H3K9(Me1)TKQTAR-K(Me1)-STGGKAPR
[Lys(Me2)9]-Histone H3 (3-17), H3K9(Me2)TKQTAR-K(Me2)-STGGKAPR
[Lys(Me3)9]-Histone H3 (3-17), H3K9(Me3)TKQTAR-K(Me3)-STGGKAPR
Histone H3 (5-23)QTARKSTGGKAPRKQLASK
[Lys(Ac)14]-Histone H3 (9-19), H3K14(Ac)KSTGG-K(Ac)-APRKQ
[Arg(Me2a)26]-Histone H3 (15-36)-GGK(Biotin), H3R26(Me2a), biotin labeledAPRKQLATKAA-R(Me2a)-KSAPATGGVKGG-K(Biotin)
[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), biotin-labeledATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin)
[Lys(Me3)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me3), biotin-labeledATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin)
Histone H3 (21-44)ATKAARKSAPATGGVKKPHRYRPG
Histone H3 (21-44)-GK(Biotin), biotin-labeledATKAARKSAPATGGVKKPHRYRPG-GK(Biotin)
Histone H3 (21-44)-GK(Biotin), biotin-labeled, amideATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
[Lys(Ac)27]-Histone 3 (21-44)-GK(Biotin); H3K27(Ac), biotin-labeledATKAAR-K(Ac)-SAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
[Lys(Me1)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Me1), biotin-labeledAT-K(Me1)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
[Lys(Ac)27]-Histone H3 (21-43)-GGK(Biotin), H3K27(Ac), biotin-labeledATKAAR-K(Ac)-SAPATGGVKKPHRYRPGG-K(Biotin)
[Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeledATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2), biotin-labeledATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin)
[Lys(Me3)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me3), biotin-labeledATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
[Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Ac), biotin-labeledATKAARKSAPATGGV-K(Ac)-KPHRYRPGG-K(Biotin)
[pSer28]-Histone H3 (21-44)-GK (Biotin), biotin-labeledATKAARK-pS-APATGGVKKPHRYRPGG-K(Biotin)
[Cit26]-Histone H3 (21-44)-GGK(Biotin)ATKAA-Cit-KSAPATGGVKKPHRYRPGGG-K(Biotin)
[Lys(Ac)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Ac), biotin-labeledAT-K(Ac)-AARKSAPATGGVKKPHRYRPGG-K(Biotin)
[Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me1), biotin-labeledATKAARKSAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
Histone H3 (23-34)KAARKSAPATGG
[Lys(Ac)27]-Histone H3 (23-34), H3K27(Ac)KAAR-K(Ac)-SAPATGG
[Lys(Me1)27]-Histone H3 (23-34), H3K27(Me1)KAAR-K(Me1)-SAPATGG
[Lys(Me2)27]-Histone H3 (23-34), H3K27(Me2)KAAR-K(Me2)-SAPATGG
[Lys(Me3)27]-Histone H3 (23-34), H3K27(Me3)KAAR-K(Me3)-SAPATGG
[Lys(Me3)27-Histone H3 (23-34)-GGK(Biotin)KAAR-K(Me3)-SAPATGGGG-K(Biotin)
[Lys(Me1)36]-Histone H3 (26-46)-K(Biotin), H3K36(Me1), Schizosaccharomyces octosporusRKAAPATGGV-K(Me1)-KPHRYRPGTV-K(BIOTIN)
[Lys(Me2)36]-Histone H3 (26-46), H3K36(Me2)RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(BIOTIN)
[Lys(Me1)36]-Histone H3 (31-41), H3K36(Me1)STGGV-K(Me1)-KPHRY
[Lys(Me2)36]-Histone H3 (31-41), H3K36(Me2)STGGV-K(Me2)-KPHRY
[Lys(Me3)36]-Histone H3 (31-41), H3K36(Me3)STGGV-K(Me3)-KPHRY
[Lys(Ac)56]-Histone H3 (44-63)GTVALREIRRYQ-K(Ac)-STELLIR
Histone H3 (69-89)-K(Biotin)RLVREIAQDFKTDLRFQSSAV-K(Biotin)
[Lys(Me2)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me2), biotin-labeledRLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)
[Lys(Me1)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me1), biotin labeledRLVREIAQDF-K(Me1)-TDLRFQSSAV-K(Biotin)
[Lys(Me3)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me3), biotin labeledRLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin)
Histone H3 (116-136), C116-136KRVTIMPKDIQLARRIRGERA
[Lys(Me1)9]-Histone H3 (1-21), H3K9(Me1)ARTKQTAR-K(Me1)-STGGKAPRKQLA
[Lys(Me1)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me1), biotin-labeledSGRGKGGKGLGKGGAKRHR-K(Me1)-VLR-GGK(Biotin)-NH2
[Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me3), biotin-labeledSGRGKGGKGLGKGGAKRHR-K(Me3)-VLR-GGK(Biotin)-NH2
[Lys(Me2)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me2), biotin-labeledSGRGKGGKGLGKGGAKRHR-K(Me2)-VLR-GGK(Biotin)-NH2
[Lys(Ac)5]-Histone H4 (1-21)-GGK(Biotin), H4K5(Ac), biotin-labeledAc-SGRG-K(Ac)-GGKGLGKGGAKRHRKVGG-K(Biotin)
[Lys(Ac)16]-Histone H4 (1-21)-GGK(Biotin), H4K16(Ac), biotin-labeledAc-SGRGKGGKGLGKGGA-K(Ac)-RHRKVGG-K(Biotin)
[Lys(Ac)8]-Histone H4 (1-21)-GGK(Biotin), H4K8(Ac), biotin-labeledAc-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin)
Histone H4 (1-23)-GSGSK, C-terminal biotin-labeledSGRGKGGKGLGKGGAKRHRKVLRGSGS-K(Biotin)
[Lys(Ac)12]-Histone H4 (1-21)-GGK(Biotin), H4K12(Ac), biotin-labeledAc-SGRGKGGKGLG-K(Ac)-GGAKRHRKVGG-K(Biotin)
Histone H4 (8-25)-WC, amideKGLGKGGAKRHRKVLRDNWC-NH2
[Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin), H4K5/8/12/16(Ac), biotin-labeledSGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVGG-K(Biotin)
Histone H4 (1-23)-GGK(Biotin), biotin labeled, amideSGRGKGGKGLGKGGAKRHRKVLRGG-K(Biotin)-NH2
[Lys(Me1)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me1), biotin-labeledAc-SGRGKGGKGLG-K(Me1)-GGAKRHRKVGG-K(Biotin)
[Lys(Me3)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me3), biotin-labeledAc-SGRGKGGKGLG-K(Me3)-GGAKRHRKVGG-K(Biotin)
[Cit3]-Histone H4 (1-23)-GGK(Biotin)SG-Cit-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)
[Arg(Me1)3]-Histone H4 (1-23)-GGK(Biotin)SG-R(Me1)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)
[Arg(Me2s)3]-Histone H4 (1-23)-GGK(Biotin)SG-R(Me2s)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)
[Lys(Ac) 5/8/12/16]-Histone H4 (1-25)-GSGSK(Biotin)SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)
[Lys(Ac)12]-Histone H4 (1-25)-GSGSK(Biotin); H4K12(Ac), biotin-labeledSGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDNGSGS-K(Biotin)
[Lys(Ac)16]-Histone H4 (1-25)-GSGSK(Biotin); H4K16(Ac), biotin-labeledSGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)
[Lys(Ac)20]-Histone H4 (1-25)-GSGSK(Biotin); H4K20(Ac), biotin-labeledSGRGKGGKGLGKGGAKRHR-K(Ac)-VLRDNGSGS-K(Biotin)
[Lys(Ac)5]-Histone H4 (1-25)-GSGSK(Biotin); H4K5(Ac), biotin-labeledSGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)
[Lys(Ac)8]-Histone H4 (1-25)-GSGSK(Biotin); H4K8(Ac), biotin-labeledSGRGKGG-K(Ac)-GLGKGGAKRHRKVLRDNGSGS-K(Biotin)
Histone H4 (1-25)-GSGSK(Biotin)SGRGKGGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)
[Lys(Ac)12/16]-Histone H4(1-25)-GSGSK(Biotin); H4K12/16(Ac), biotin-labeledSGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)
Histone H4 (1-7), N-TerminalSGRGKGG
[Arg(Me2a)3]-Histone H4 (1-23)-GGK(Biotin)SG-R(Me2a)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)
[Lys(Ac)12/16, Lys(Me3)20]-Histone H4 (1-25)-GSGSK(Biotin)SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me3)-VLRDNGSGS-K(Biotin)
[Lys(Ac)5/8/12/16]-Histone H4 (1-25)-GSGSKSGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
[Lys(Me1)20]-Histone H4 (8-30)-WGK(Biotin); H4K20(Me1) (8-30), biotin-labeledAc-KGLGKGGAKRHR-K(Me1)-VLRDNIQGIT-WGK(biotin)
Histone H4 (8-30)-WGK(Biotin)Ac-KGLGKGGAKRHRKVLRDNIQGIT-WGK(biotin)
[Lys(Me2)20]-Histone H4 (8-30)-WGK(Biotin); H4K20(Me2) (8-30), biotin-labeledAc-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)
[Lys(Me3)20]-Histone H4 (8-30)-WGK(Biotin); H4K20(Me3) (8-30), biotin-labeledAc-KGLGKGGAKRHR-K(Me3)-VLRDNIQGITWG-K(biotin)
Histone H4 (1-20), PRMT7 Substrate, M1SGRGKGGKGLGKGGAKRHRK-NH2
[Lys(Ac)5]-Histone H4 (1-20), H4K5(Ac)SGRG-K(Ac)-GGKGLGKGGAKRHRK
[Lys(Ac)8]-Histone H4 (1-20), H4K8(Ac)SGRGKGG-K(Ac)-GLGKGGAKRHRK
[Lys(Ac)12]-Histone H4 (1-20), H4K12(Ac)SGRGKGGKGLG-K(Ac)-GGAKRHRK
[Lys(Ac)16]-Histone H4 (1-20), H4K16(Ac)SGRGKGGKGLGKGGA-K(Ac)-RHRK
Histone H4 (1-21)-Lys(Biotin)Ac-SGRGKGGKGLGKGGAKRHRKVGG-K(Biotin)
Histone H4 (1-21), p300/CBP SubstrateSGRGKGGKGLGKGGAKRHRKV
[Arg(Me1)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me1), biotin-labeledAc-SG-R(Me1)-GKGGKGLGKGGAKRHRKVGG-K(Biotin)
[Arg(Me2a)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me2a), biotin-labeledAc-SG-R(Me2a)-GKGGKGLGKGGAKRHRKVGG-K(Biotin)
[Arg(Me2s)3]-Histone H4 (1-21)-GGK(Biotin); H4R3(Me2s) (1-21), biotin-labeledAc-SG-R(me2s)-GKGGKGLGKGGAKRHRKV-GGK(biotin)
AKT/PKB/Rac-Protein Kinase Substrate [ARKRERTYSFGHHA], BiotinylatedBiotin-ARKRERTYSFGHHA
CDK5 SubstratePKTPKKAKKL
Histone deacetylase, HDAC substrateAc-RGK(Ac)-AMC
C34, gp41 HIV FragmentWMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
Gag Spacer Peptide P1HHHHHHIIKIIK
Prostatic Acid Phosphatase (248-286), PAP (248-286)GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
T20Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
Integrin-Binding Site, GRGDNPGRGDNP
Laminin PentapeptideYIGSR
GALA, Pore-Forming PeptideWEAALAEALAEALAEHLAEALAEALEALAA
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Crosstide [GRPRTSSFAEG]GRPRTSSFAEG
Autocamtide-2[KKALRRQETVDAL]KKALRRQETVDAL
Syntide-2[PLARTLSVAGLPGKK]PLARTLSVAGLPGKK
HATPPKKKRKHATPPKKKRK
CK1 Peptide Substrate [pS7]KRRRAL-pS-VASLPGL
Casein Kinase 2 (CK2) Substrate α-subunitRRRDDDSDDD
Glycogen Synthase 1-10, 5-FAM labeled5-FAM-PLSRTLSVSS-NH2
Insulin Receptor (1142-1153), pTyr(1146, 1150, 1151)TRDI-pY-ETD-pY-pY-RK
Insulin Receptor (1142-1153), pTyr1146TRDI-pY-ETDYYRK
Insulin Receptor (1142-1153), pTyr1150TRDIYETD-pY-YRK
Syk Kinase Peptide SubstrateKEDPDYEWPSAK-NH2
Syk Kinase Peptide Substrate, Biotin labeledBiotin-KEDPDYEWPSAK-NH2
MBP, MAPK Substrate, BiotinylatedBiotin-APRTPGGRR
MBP, MAPK Substrate, Biotinylated, PhosphorylatedBiotin-APR-pT-PGGRR
Myosin Regulatory Light Chain MRCL3 (11-24)KKRPQRATSNVFAM-NH2
pp60(v-SRC) Autophosphorylation Site, PhosphorylatedRRLIEDNE-pY-TARG
CREBtide [KRREILSRRPSYR]KRREILSRRPSYR
CREBtide [KRREILSRRPSYR], Phosphorylated, C-term KKRREILSRRPS-pY-RK
Kemptide [LRRASLG]LRRASLG
[Ser25]-PKC (19-31), biotinylatedK(Biotin)-RFARKGSLRQKNV
Neurogranin 28-43[AAKIQASFRGHMARKK], Biotinylated-LCBiotin-LC-AAKIQASFRGHMARKK
PKC (Protein Kinase C) SubstrateERMRPRKRQGSVRRRV
PKG Substrate [RKRSRAE], GlasstideRKRSRAE
P70 S6 Kinase SubstrateKKRNRTLTV
S6 Kinase Substrate (229-239)AKRRRLSSLRA
S6 Kinase Substrate (229-239), Amide, BiotinalytedBiotin-AKRRRLSSLRA-NH2
SrctideGEEPLYWSFPAKKK-NH2
Srctide, biotinylatedBiotin-GEEPLYWSFPAKKK-NH2
Srctide, FAM labeled5-FAM-GEEPLYWSFPAKKK-NH2
LKBtide; LKB1/STK11 Substrate PeptideLSNLYHQGKFLQTFCGSPLYRRR
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5-TMR labeledKVEKIGEGTYGVVYK
Tyrosine Kinase Peptide 3 [RRLIEDAE-pY-AARG], PhosphorylatedRRLIEDAE-pY-AARG
Luteinizing Hormone-Releasing Hormone (LH-RH), humanPyr-HWSYGLRPG-NH2
Cetrorelix Acetate, CetrotideAc-{d-A[3-(2-naphthyl)]}-[d-F(4-Cl)]-{d-A[3-(3-pyridyl)]}-SY-(d-Cit)-LRP-d-A-NH2?Acetate
MAPS, Core, 8-BranchK4K2KA-NH2
[Leu27]-Melan-A, MART 1 (26-35)ELAGIGILTV
Melan-A, MART 1 (26-35)EAAGIGILTV
Melan-A/MART-1 (27-35)AAGIGILTV
MUC1, mucin coreGVTSAPDTRPAPGSTA
NDP-MSH, 5-TAMRA-labeled5-TMR-SYS-Nle-EHfRWGKPV-NH2
Adeno-Associated Virus Epitope 2 (AAV2)VPQYGYLTL
BDC2.5 mimotope 1040-31YVRPLWVRME
Dby HY PeptideNAGFNSNRANSSRSS
Eα (52-68)ASFEAQGALANIAVDKA
Glutamic Acid Decarboxylase (GAD65) (524-543), p524-543SRLSKVAPVIKARMMEYGTT
IL-8 InhibitorAc-RRWWCR-NH2
LCMV (276-286), GP276SGVENPGGYCL
LCMV gp33-41KAVYNFATM
LLO190NEKYAQAYPNVS
Mgp100 (25-33), mouseEGSRNQDWL
NY-ESO-1 (87-111)LLEFYLAMPFATPMEAELARRSLAQ
Uty HY Peptide (246-254), mouseWMHHNMDLI
Plasmepsin V FRET SubstrateDabcyl-LNKRLLHETQ-EDANS
Poly-γ-D-Glutamic Acid ConstructAc-(γ-e)15-C-NH2
Humanin, HNMAPRGFSCLLLLTSEIDLPVKRRA
MOTS-cH-MRWQEMGYIFYPRKLR-OH
SHLP1 (Small humanin-like peptide 1)H-MCHWAGGASNTGDARGDVFGKQAG-OH
SHLP3 (Small humanin-like peptide 3)H-MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW-OH
SHLP4 (Small humanin-like peptide 4)H-MLEVMFLVNRRGKICRVPFTFFNLSL-OH
SHLP6 (Small humanin-like peptide 6)H-MLDQDIPMVQPLLKVRLFND-OH
MOG (35-55), mouse, ratMEVGWYRSPFSRVVHLYRNGK
MOG (35-55), humanMEVGWYRPPFSRVVHLYRNGK
MOG (89-113), humanRFSDEGGFTCFFRDHSYQEEAAMEL
MOG (92-106)DEGGYTCFFRDHSYQ
MBP (4-14), bovine, MBP (3-13), mouseQKRPSQRSKYL
MBP (69-85), guinea pigYGSLPQKSQRSQDENPV
MBP (85-98), guinea pig, MBP (86-99), human, MBP (83-96) mouseVVHFFKNIVTPRTP
MBP (85-106) guinea pig, MBP (86-107), humanVVHFFKNIVTPRTPPPSQGKGR
MBP (84-96), mouse, MBP (86-98), guinea pig, MBP (87-99), humanVHFFKNIVTPRTP
MBP (88-104), guinea pig, MBP (89-105), human, MBP (86-102), mouseAc-FFKNIVTPRTPPPSQGK-NH2
MBP MAPK SubstrateAPRTPGGRR
Biotin-LC-MBP Derivatized PeptideBiotin-LC-FFKNIVTPRTPPPSQGK-NH2
Myosin H Chain Fragment, mouseAc-RSLKLMATLFSTYASADR
Nesfatin-1 (24-53), humanPDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2
Nesfatin-1 (24-53), mousePDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2
biotin-Neurogranin (48-76), humanBiotin-SGERGRKGPGPGGPGGAGVARGGAGGGPS
biotin-Neurogranin (48-76), mouseBiotin-SGECGRKGPGPGGPGGAGGARGGAGGGPS
Neurogranin (48-76), humanSGERGRKGPGPGGPGGAGVARGGAGGGPS
Neurogranin (48-76), mouseSGECGRKGPGPGGPGGAGGARGGAGGGPS
Glutamate Receptor Endocytosis Inhibitor, GluR23YYKEGYNVYG
LCMV GP61GLNGPDIYKGVYQFKSVEFD
LCMV NP396 H-2Db peptideFQPQNGQFI
MOG (44-54), mouse, human, ratFSRVVHLYRNG
Neuropeptide S, NPS, humanSFRNGVGTGMKKTSFQRAKS
Neuropeptide S, NPS, mouseSFRNGVGSGAKKTSFRRAKQ
P0 (180-199)Peripheral Myelin P0 Protein (180-199), mouse
P2 (53-78)Peripheral Myelin Protein P2 (53-78), bovine
SecretoneurinTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
IKKγ NEMO Binding Domain (NBD) Inhibitory PeptideDRQIKIWFQNRRMKWKKTALDWSWLQTE
NF-kB Inhibitor, SN50AAVALLPAVLLALLAPVQRKRQKLMP
Orexin B, humanRSGPPGLQGRLQRLLQASGNHAAGILTM-NH2
Orexin B, mouseRPGPPGLQGRLQRLLQANGNHAAGILTM-NH2
[Gla17,21,24]-Osteocalcin (1-49)YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
Des-gamma-carboxylated Osteocalcin/Bone Gla ProteinYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
OVA (241-270)SMLVLLPDEVSGLEQLESIINFEKLTEWTS
OVA (257-264)SIINFEKL
OVA (257-264), amideSIINFEKL-NH2
OVA (257-264), FAM labeled5-FAM-SIINFEKL-NH2
OVA (257-264), scrambled, FILKSINEFILKSINE
OVA (323-339)ISQAVHAAHAEINEAGR
OVA (323-339), amideISQAVHAAHAEINEAGR-NH2
OVA (323-339), biotin-labeledBiotin-ISQAVHAAHAEINEAGR
OVA (323-339), FITC-labeledFITC-LC-ISQAVHAAHAEINEAGR
OVA (323-339), TAMRA labeled5-TAMRA-ISQAVHAAHAEINEAGR
OVA (329-337)AAHAEINEA
OVA-A2 Peptide, SAINFEKL, OVA (257-264) VariantSAINFEKL
OVA-G4 Peptide, SIIGFEKL, OVA (257-264) VariantSIIGFEKL
OVA-Q4 Peptide, pQ4, SIIQFEKL, OVA (257-264) VariantSIIQFEKL
OVA-Q4H7 Peptide, pQ4H7, SIIQFEHL, OVA (257-264) VariantSIIQFEHL
OVA-T4 Peptide, SIITFEKL, pT4, OVA (257-264) VariantSIITFEKL
Aquaporin-2 (254-267), pSER261, humanRQSVELH-pS-PQSLPR
[Lys(Ac)382]-p53 (361-393), biotin labeled, amide, humanBiotin-LC-GSRAHSSHLKSKKGQSTSRHK-K(Ac)-LMFKTEGPDSD-NH2
[Lys(Ac)382]-p53 (372-389), biotin labeledBiotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
p53 (17-26)ETFSDLWKLL
TP53 Q9NP68, p53 Mutant Form (372-389), Lys382 (Ac)KKGQSTSRHK-K(Ac)-LMFKTEG
Parathyroid Hormone (1-13)SVSEIQLMHNLGK
Parathyroid Hormone (1-34), humanSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Parathyroid Hormone (1-34), human, biotinylatedBiotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Parathyroid Hormone (1-34)-Lys(Biotin), humanSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
TIP 39, Tuberoinfundibular NeuropeptideSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Ala-γ-D-Glu-DAPA-(γ-e)-DAP
Keratin K18-CRPVSSAApSVYAGAC
Threonine Phosphopeptide,PKC Substrate 4, phosphorylatedKR-pT-IRR
UOM9, PKC Substrate, phosphorylatedKRP-pS-QRHGSKY-NH2
Phytochelatin 2, PC2(γE-C)2-G
Phytochelatin 3, PC3(γE-C)3-G
Phytochelatin 4, PC4(γE-C)4-G
Phytochelatin 5, PC5(γE-C)5-G
Phytochelatin 6, PC6(γE-C)6-G
PrP (106-126)KTNMKHMAGAAAAGAVVGGLG
Calpain Inhibitor Peptide, B27-WTDPMSSTYIEELGKREVTIPPKYRELLA
[Ser140]-PLP (139-151)HSLGKWLGHPDKF
PLP (139-151)HCLGKWLGHPDKF
PLP (178-191)NTWTTCQSIAFPSK
PLP (180-199)WTTCQSIAFPSKTSASIGSL
ε-V1-2, ε-PKC InhibitorEAVSLKPT
AbltideKKGEAIYAAPFA-NH2
AMARA peptideAMARAASAAALARRR
Bovine β-Casein, monophosphopeptideFQ-pS-EEQQQTEDELQDK
Cathepsin D and E FRET SubstrateMca-GKPILFFRLK(Dnp)-r-NH2
Cathepsin K substrateAbz-HPGGPQ-EDDnp
CDK7/9 tideYSPTSPSYSPTSPSYSPTSPSKKKK
DNA-PK SubstrateEPPLSQEAFADLWKK
epsilon-V1-2, epsilon-PKC Inhibitor, Cys-conjugatedEAVSLKPTC
ErktideIPTTPITTTYFFFK
Forkhead derived peptide, WoodtideKKISGRLSPIMTEQ-NH2
GSK3 Substrate, a, b subunitRAAVPPSPSLSRHSSPHQSEDEEE
IRS1-derived peptideKKSRGDYMTMQIG-NH2
Jak3tideGGEEEEYFELVKKKK
MLC-derived peptideKKRPQRRYSNVF
Myristolated PKC Zeta, Pseudosubstrate (ZIP)Myr-SIYRRGARRWRKL
Myristolated PKC Zeta, Pseudosubstrate ZIP, ScrambledMyristoyl-RLYRKRIWRSAGR
PDKtideKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
Psi-RACK, epsilon-C2/V1 (82-92), epsilon PKC (82-92), C2 DomainHDAPIGYD
RS domain derived peptideGRSRSRSRSR
S3 Fragment, ADF/cofilinMASGVMVSDDVVKVFN
SAMS PeptideHMRSAMSGLHLVKRR-NH2
Src Optimal Peptide SubstrateAEEEIYGEFEAKKKK
Renin FRET Substrate IDABCYL-g-Abu-IHPFHLVIHT-EDANS
Renin Substrate, humanDRVYIHPFHLVIHN
IRBP (1-20), humanGPTHLFQPSLVLDMAKVLLD
IRBP derived peptide, R16ADGSSWEGVGVVPDV
IRBP, Interphotoreceptor Retinoid Binding Protein FragmentSGIPYIISYLHPGNTILHVD
GRGDSGRGDS
GRGDSPGRGDSP
GRGDSPKGRGDSPK
GRGDTPGRGDTP
Prototype of RGD-containing peptide, FITC-labeledFITC-LC-GRGDSP
RGDSRGDS
Prosaptide TX14(A)TaLIDNNATEEILY
DyrktideRRRFRPASPLRGPPK
JAG-1 (188-204), Jagged-1 (188-204), Notch Ligand, DSL PeptideCDDYYYGFGCNKFCRPR
M13 Skeletal Muscle Myosin Light Chain Kinase Peptide, SK-MLCK M13KRRWKKNFIAVSAANRFKKISSSGAL
Pannexin-1 (Panx1), Mimetic Blocking PeptideWRQAAFVDSY
Scrambled Jag1RCGPDCFDNYGRYKYCF
Steroid Receptor Co-Factor PeptideLTERHKILHRLLQE
Steroid Receptor Coactivator-1 (SRC-1), (676-700), biotin labeledBiotin-CPSSHSSLTERHKILHRLLQEGSPS
Steroid Receptor Coactivator-1, SRC-1 (686-700)RHKILHRLLQEGSPS
TET 830 modified/T-helper epitope from tetanus toxoidAQYIKANSKFIGITEL
TIF2 (740-753), Transcriptional Intermediary Factor 2 (740-753)KENALLRYLLDKDD
W Peptide, WKYMVm-NH2WKYMVm-NH2
WRW4, Formyl Peptide Receptor-Like 1 (FPRL1) AntagonistWRWWWW
Spexin (36-49), amidated, human/mouse/ratNWTPQAMLYLKGAQ-NH2
Spexin-2 (53-70), amidated, human/mouse/ratFISDQSRRKDLSDRPLPE-NH2
Spexin-2 (53-70), human/mouse/ratFISDQSRRKDLSDRPLPE
3 x Hemagglutinin (HA) TagMEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
DYKDDDDKDYKDDDDK
Glu-Glu epitope TagEYMPME
HA 12CA5 EpitopeCYPYDVPDYA
HA peptideYPYDVPDYA
Hexa HisHHHHHH
Rhodopsin Epitope TagTETSQVAPA
V5 Epitope TagGKPIPNPLLGLDST
Tau Peptide (45-73) (Exon 2/Insert 1 domain)ESPLQTPTEDGSEEPGSETSDAKSTPTAE
Tau Peptide (244-274) (Repeat 1 domain)Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Tau Peptide (275-305) (Repeat 2 domain)VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS
Tau Peptide (306-336) (Repeat 3 domain)VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Tau Peptide (337-368) (Repeat 4 domain)VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
[Ser(OGlcNAc)]400-KWK-Tau (388-411)-KK(Biotin)-NH2KWKHGAEIVYKSPVV-S(OGlcNAc)-GDTSPRHLSNVK-K(biotin)-NH2
Thrombin Receptor Agonist,amide (SFLLR-NH2)SFLLR-NH2
Thrombin Receptor Agonist (FLLRN)FLLRN
STAL-2SFLLRN-NH2
Scrambled TRAP FragmentFSLLRN-NH2
SLLK, Control Peptide for TSP1 InhibitorSLLK-NH2
ω-Conotoxin GVIACKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2
Caloxin 1b1TAWSEVLHLLSRGGG
Caloxin 2A1VSNSNWPSFPSSGGG
Caloxin 3A1WSSTSSVSAPLEFGGGGSAK
Conantokin GGE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN-NH2
Delta-Toxin (1-26), Staphylococcus aureusMAQDIISTIGDLVKWIIDTVNKFTKK
Tetanus Toxin (830-844)QYIKANSKFIGITEL
[Lys(Ac)40]-Ac-a-Tubulin (29-50)-WGK(Biotin); TubK40(Ac)-WGK, biotin-labeledAc-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin)
B8R (20-27)TSYKFESV
CKS-17 (dimer), MN10021LQNRRGLDLLFLKEGGLC (dimer)
CMV pp65 peptideSVLGPISGHVLKAVF
HSV-gB2 (498-505)SSIEFARL
Human Papillomavirus (HPV) E7 protein (49-57)RAHYNIVTF
Influenza A NP (366-374) Strain A/NT/60/68ASNENMDAM
Influenza HA (307-319)PKYVKQNTLKLAT
Influenza Matrix Protein (62-70), MP (62-70)GFVFTLTVPSER
Influenza NP (147-155)TYQRTRALV
Influenza Virus Nucleoprotein (311-325)QVYSLIRPNENPAHK
IV9 (476-484), HIV-1 RT EpitopeILKEPVHGV
LCMV GP (61-80)GLKGPDIYKGVYQFKSVEFD
Lymphocytic Choreomeningitis Virus (LCMV) Glycoprotein 33 (33-41), LCMV GP1, gp 33 (33-41)KAVYNFATC
PA (224-233), InfluenzaSSLENFRAYV
Plasmodium falciparum Circumsporozoite Protein, (6NANP) PfCSPNANPNANPNANPNANPNANPNANPC
VSV-G PeptideYTDIEMNRLGK
(Des-His⁶)-ACTH (1-24) (human, bovine, rat)SYSMEFRWGKPVGKKRRPVKVYP
Acetyl-ACTH (3-24) (human, bovine, rat)Ac-SMEHFRWGKPVGKKRRPVKVYP
(Des-Glu⁵)-ACTH (1-24) (human, bovine, rat)SYSMHFRWGKPVGKKRRPVKVYP
Acetyl-ACTH (7-24) (human, bovine, rat)Ac-FRWGKPVGKKRRPVKVYP
ACTH (2-24) (human, bovine, rat)YSMEHFRWGKPVGKKRRPVKVYP
(Des-Ser3)-ACTH (1-24) (human, bovine, rat)SYMEHFRWGKPVGKKRRPVKVYP
Acetyl-ACTH (2-24) (human, bovine, rat)Ac-YSMEHFRWGKPVGKKRRPVKVYP
Endo-4a-Glu-ACTH (1-24) (human, bovine, rat)SYSMEEHFRWGKPVGKKRRPVKVYP
Acetyl-ACTH (4-24) (human, bovine, rat)Ac-MEHFRWGKPVGKKRRPVKVYP
ACTH (3-24) (human, bovine, rat)SMEHFRWGKPVGKKRRPVKVYP
ACTH (1-14)SYSMEHFRWGKPVG
ACTH (1-16), humanSYSMEHFRWGKPVGKK
α-MSH (4-10), ACTH (4-10), humanMEHFRWG
ACTH (11-24)KPVGKKRRPVKVYP
ACTH (22-39)VYPNGAEDESAEAFPLEF
ACTH (1-13), humanSYSMEHFRWGKPV
ACTH (1-4)SYSM
ACTH (1-39) (mouse, rat)SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
N-Acetyl-ACTH (1-17), humanAc-SYSMEHFRWGKPVGKKR
R-E-D-VREDV
Procollagen Type I (212-216)KTTKS
Collagen Type I α1 chain (502-516)H-Gly-Phe-Hyp-Gly-Glu-Arg-Gly-Val-Glu-Gly-Pro-Hyp-Gly-Pro-Ala-NH₂
Ac-Pro-Gly-Pro (PGP)Ac-PGP
Annexin A1 (1-25) (dephosphorylated) (human)Ac-AMVSEFLKQAWFIENEEQEYVQTVK
Neural-Cadherin (76-85) amide (chicken)LRAHAVDVNG-NH₂
Osteoblast-Adhesive PeptideKRSR
α₂β₁ Integrin Recognition SequenceDGEA