| Product Name | Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, Amide |
| Purity | HPLC>95% |
| Description | Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. |
| Storage | -20°C |
| References | McQueen, J. Am. J. Health-System Pharmacy 62 2363 (2005). |
| Molecular Weight | 3904.5 |
| Sequence (One-Letter Code) | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt |
| Sequence (Three-Letter Code) | H - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - His - Ser - Ser - Asn - Asn - Phe - Gly - Pro - Ile - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2 acetate salt (S - S Bond) |
Other Products
Related Products
