| Product Name | 5-FAM-LL-37 |
| Purity | HPLC>95% |
| Description | FAM-labeled (ab/em = 494/518nm) LL-37. LL-37 is an antimicrobial peptide with angiogenic activity. It corresponds to the C-terminal sequence (134-170) of the human cathelicidin antimicrobial protein hCAP18/LL-37. hCAP18/LL-37 is an effector of the innate immune system and is expressed in leukocytes and epithelial cells where it is upregulated in association with inflammation and injury. An overexpression of hCAP18/LL-37 in a series of breast carcinomas could be demonstrated. LL-37 has been suggested to stimulate epithelial cell proliferation partially through formyl peptide receptor-like 1 (FPRL1). |
| Storage | -20°C |
| References | |
| Molecular Weight | 4851.63 |
| Sequence (One-Letter Code) | 5-FAM-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Sequence (Three-Letter Code) | Fluorescein-5-carbonyl-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
Other Products
Related Products
