Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

β-Amyloid (1-40) (scrambled II)

Home/Beta Amyloid Peptides/β-Amyloid (1-40) (scrambled II)
β-Amyloid (1-40) (scrambled II)Admin2020-12-18T13:14:52+00:00
Product Name β-Amyloid (1-40) (scrambled II)
Purity HPLC>95%
Description This peptide is a specifically designed negative control in studies with Abeta40. It is "scrambled", which means it contains the same amino acids as Abeta40, but in different order. Referring to studies by Yamin and coworkers, Teplow's Amyloid β-Protein (1-40) does not show a number of phenomena regularly observed with Abeta40 (fibril formation, oligomerization, toxicity to neurons) and furthermore has a relatively flat hydropathy profile, which can be an advantage in several studies, for example in order to avoid unspecific interaction with the cell membrane.
Storage -20°C
References G.Yamin et al., Biochemistry, 55, 5049 (2016)
Molecular Weight 4329.86
Sequence (One-Letter Code) YHAGVDKEVVFDEGGAEHGLAQKIVRGFGVSDVSMIHNLF
Sequence (Three-Letter Code) H-Tyr-His-Ala-Gly-Val-Asp-Lys-Glu-Val-Val-Phe-Asp-Glu-Gly-Gly-Ala-Glu-His-Gly-Leu-Ala-Gln-Lys-Ile-Val-Arg-Gly-Phe-Gly-Val-Ser-Asp-Val-Ser-Met-Ile-His-Asn-Leu-Phe-OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

  • Ginsenoside Re
  • Semagacestat
  • Beta-Amyloid (1-42), Human
  • Beta-Amyloid (1-42), FAM-labeled, Human
  • [Met]-beta-Amyloid (1-42), 5-TAMRA labeled, Human
Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top