| Product Name | β-Amyloid (1-40) (scrambled II) |
| Purity | HPLC>95% |
| Description | This peptide is a specifically designed negative control in studies with Abeta40. It is "scrambled", which means it contains the same amino acids as Abeta40, but in different order. Referring to studies by Yamin and coworkers, Teplow's Amyloid β-Protein (1-40) does not show a number of phenomena regularly observed with Abeta40 (fibril formation, oligomerization, toxicity to neurons) and furthermore has a relatively flat hydropathy profile, which can be an advantage in several studies, for example in order to avoid unspecific interaction with the cell membrane. |
| Storage | -20°C |
| References | G.Yamin et al., Biochemistry, 55, 5049 (2016) |
| Molecular Weight | 4329.86 |
| Sequence (One-Letter Code) | YHAGVDKEVVFDEGGAEHGLAQKIVRGFGVSDVSMIHNLF |
| Sequence (Three-Letter Code) | H-Tyr-His-Ala-Gly-Val-Asp-Lys-Glu-Val-Val-Phe-Asp-Glu-Gly-Gly-Ala-Glu-His-Gly-Leu-Ala-Gln-Lys-Ile-Val-Arg-Gly-Phe-Gly-Val-Ser-Asp-Val-Ser-Met-Ile-His-Asn-Leu-Phe-OH |
β-Amyloid (1-40) (scrambled II)Admin2020-12-18T13:14:52+00:00